16 Commits

Author SHA1 Message Date
bbfa367775 Slightly better ICACHE hits 2022-12-09 09:20:34 +01:00
951ed73024 Slow O(n) algorithm for part 2 2022-12-08 22:57:36 +01:00
79387b5f14 Slightly more efficient O(kn) implementation 2022-12-08 22:40:39 +01:00
a05dc588db Implement 2022 day 8 part 2 2022-12-08 12:09:04 +01:00
b080859356 Replace todo with error, bench everything 2022-12-08 11:06:59 +01:00
fead587b2a Implement 2022 day 8 part 1 2022-12-08 11:01:48 +01:00
eec886b5e2 Slightly cleaner parser 2022-12-07 16:01:09 +01:00
45a6c78d77 Remove most allocations 2022-12-07 15:27:30 +01:00
e80b5bde68 Implement 2022 day 7 2022-12-07 10:27:06 +01:00
1cd5579bf6 Use iterators instead of explicit indexing 2022-12-06 18:37:38 +01:00
7c7c69255d Replace indirect indexing
230 byte overhead is worth it to avoid conversions and potential
indexing errors
2022-12-06 18:23:43 +01:00
391bba24c5 Use enumerate combinator 2022-12-06 18:19:42 +01:00
e887a8ad0d Implement 2022 day 6 2022-12-06 08:29:26 +01:00
38a024d095 Implement 2022 day 5 2022-12-05 11:14:36 +01:00
6802a7bf33 Refactor common parts 2022-12-04 11:18:03 +01:00
9d23e80256 Implement 2022 day 4 2022-12-04 11:14:23 +01:00
33 changed files with 3280 additions and 54 deletions

View File

@@ -8,7 +8,7 @@ use criterion::BenchmarkId;
use criterion::Criterion; use criterion::Criterion;
/// Number of days we have an implementation to benchmark /// Number of days we have an implementation to benchmark
const DAYS_IMPLEMENTED: u8 = 3; const DAYS_IMPLEMENTED: u8 = 25;
fn read_input(day: u8) -> Vec<u8> { fn read_input(day: u8) -> Vec<u8> {
let input_path = format!("inputs/{:02}.txt", day); let input_path = format!("inputs/{:02}.txt", day);

1000
2022/inputs/04.txt Normal file

File diff suppressed because it is too large Load Diff

514
2022/inputs/05.txt Normal file
View File

@@ -0,0 +1,514 @@
[G] [D] [Q]
[P] [T] [L] [M] [Z]
[Z] [Z] [C] [Z] [G] [W]
[M] [B] [F] [P] [C] [H] [N]
[T] [S] [R] [H] [W] [R] [L] [W]
[R] [T] [Q] [Z] [R] [S] [Z] [F] [P]
[C] [N] [H] [R] [N] [H] [D] [J] [Q]
[N] [D] [M] [G] [Z] [F] [W] [S] [S]
1 2 3 4 5 6 7 8 9
move 7 from 6 to 8
move 5 from 2 to 6
move 2 from 4 to 1
move 1 from 4 to 5
move 5 from 7 to 6
move 7 from 6 to 3
move 5 from 9 to 2
move 6 from 2 to 3
move 2 from 7 to 9
move 20 from 3 to 1
move 11 from 1 to 6
move 1 from 9 to 8
move 3 from 8 to 2
move 8 from 1 to 5
move 10 from 8 to 4
move 7 from 6 to 4
move 1 from 8 to 3
move 8 from 1 to 7
move 16 from 4 to 8
move 1 from 9 to 8
move 1 from 5 to 2
move 4 from 7 to 4
move 5 from 6 to 7
move 1 from 6 to 1
move 8 from 7 to 4
move 1 from 6 to 9
move 12 from 4 to 5
move 3 from 2 to 5
move 1 from 6 to 2
move 1 from 3 to 7
move 1 from 3 to 2
move 1 from 9 to 3
move 1 from 7 to 8
move 1 from 7 to 5
move 1 from 3 to 2
move 4 from 5 to 7
move 5 from 5 to 7
move 1 from 4 to 3
move 1 from 3 to 9
move 3 from 1 to 8
move 1 from 9 to 1
move 2 from 2 to 1
move 2 from 2 to 7
move 8 from 8 to 1
move 3 from 5 to 2
move 8 from 7 to 5
move 7 from 1 to 3
move 3 from 1 to 7
move 1 from 1 to 5
move 1 from 3 to 7
move 7 from 5 to 8
move 2 from 2 to 8
move 1 from 3 to 2
move 1 from 2 to 4
move 1 from 4 to 8
move 13 from 8 to 1
move 13 from 5 to 9
move 2 from 5 to 2
move 7 from 9 to 3
move 12 from 8 to 3
move 4 from 9 to 3
move 1 from 3 to 4
move 2 from 2 to 3
move 1 from 1 to 6
move 1 from 2 to 3
move 1 from 5 to 9
move 7 from 7 to 4
move 10 from 1 to 8
move 1 from 1 to 4
move 1 from 9 to 5
move 2 from 5 to 1
move 1 from 6 to 5
move 3 from 8 to 9
move 5 from 4 to 3
move 4 from 4 to 1
move 7 from 1 to 6
move 2 from 5 to 7
move 35 from 3 to 4
move 4 from 9 to 1
move 19 from 4 to 8
move 1 from 7 to 6
move 1 from 9 to 2
move 10 from 4 to 5
move 2 from 4 to 7
move 3 from 4 to 3
move 1 from 2 to 8
move 1 from 1 to 9
move 3 from 3 to 6
move 4 from 8 to 6
move 4 from 5 to 2
move 2 from 8 to 3
move 3 from 5 to 9
move 12 from 6 to 1
move 8 from 8 to 6
move 2 from 9 to 1
move 1 from 4 to 1
move 1 from 3 to 8
move 3 from 7 to 8
move 2 from 9 to 7
move 1 from 6 to 7
move 10 from 6 to 8
move 4 from 2 to 5
move 1 from 3 to 7
move 7 from 5 to 7
move 13 from 8 to 1
move 29 from 1 to 4
move 8 from 7 to 8
move 1 from 1 to 3
move 3 from 7 to 6
move 1 from 1 to 9
move 15 from 4 to 1
move 1 from 3 to 6
move 10 from 1 to 6
move 10 from 6 to 7
move 1 from 4 to 9
move 1 from 9 to 1
move 1 from 9 to 7
move 6 from 7 to 8
move 1 from 1 to 6
move 5 from 6 to 5
move 21 from 8 to 9
move 5 from 1 to 9
move 2 from 9 to 5
move 3 from 5 to 6
move 3 from 7 to 9
move 4 from 4 to 6
move 6 from 8 to 7
move 6 from 6 to 3
move 2 from 7 to 9
move 1 from 7 to 2
move 6 from 3 to 2
move 1 from 6 to 4
move 4 from 5 to 9
move 1 from 4 to 5
move 9 from 4 to 6
move 7 from 6 to 4
move 10 from 9 to 2
move 5 from 7 to 5
move 10 from 2 to 7
move 2 from 5 to 4
move 2 from 5 to 9
move 4 from 9 to 4
move 1 from 8 to 6
move 7 from 7 to 2
move 1 from 5 to 4
move 2 from 7 to 1
move 1 from 5 to 7
move 3 from 6 to 2
move 4 from 4 to 5
move 1 from 2 to 7
move 10 from 4 to 7
move 3 from 7 to 3
move 17 from 9 to 4
move 1 from 1 to 4
move 1 from 1 to 5
move 5 from 2 to 7
move 1 from 9 to 2
move 5 from 4 to 8
move 2 from 9 to 7
move 4 from 8 to 1
move 3 from 4 to 8
move 1 from 2 to 5
move 1 from 9 to 2
move 6 from 4 to 8
move 3 from 7 to 5
move 1 from 4 to 9
move 1 from 9 to 1
move 3 from 1 to 9
move 4 from 8 to 5
move 2 from 9 to 8
move 4 from 2 to 5
move 8 from 7 to 2
move 5 from 8 to 5
move 2 from 7 to 8
move 1 from 3 to 5
move 1 from 1 to 2
move 1 from 1 to 6
move 2 from 3 to 6
move 5 from 2 to 8
move 4 from 7 to 1
move 7 from 8 to 5
move 1 from 1 to 5
move 3 from 8 to 3
move 1 from 9 to 3
move 7 from 2 to 3
move 2 from 2 to 8
move 2 from 4 to 8
move 1 from 8 to 5
move 1 from 1 to 4
move 2 from 4 to 7
move 2 from 7 to 1
move 3 from 2 to 3
move 3 from 5 to 2
move 1 from 8 to 3
move 3 from 3 to 2
move 5 from 2 to 1
move 17 from 5 to 8
move 9 from 8 to 1
move 11 from 3 to 5
move 8 from 8 to 5
move 2 from 8 to 5
move 16 from 1 to 4
move 13 from 4 to 7
move 6 from 5 to 2
move 2 from 4 to 8
move 5 from 7 to 9
move 2 from 1 to 2
move 7 from 7 to 1
move 1 from 1 to 4
move 1 from 9 to 8
move 7 from 2 to 8
move 1 from 4 to 7
move 2 from 9 to 4
move 1 from 4 to 1
move 1 from 3 to 5
move 2 from 9 to 8
move 11 from 8 to 7
move 2 from 6 to 5
move 1 from 6 to 9
move 1 from 1 to 9
move 1 from 9 to 1
move 4 from 1 to 4
move 2 from 1 to 8
move 1 from 1 to 2
move 1 from 9 to 5
move 2 from 4 to 3
move 2 from 2 to 7
move 2 from 3 to 9
move 1 from 9 to 1
move 1 from 9 to 1
move 5 from 5 to 1
move 19 from 5 to 6
move 5 from 1 to 4
move 1 from 2 to 9
move 1 from 1 to 3
move 7 from 5 to 8
move 1 from 3 to 6
move 8 from 7 to 3
move 7 from 4 to 8
move 3 from 8 to 5
move 1 from 4 to 1
move 1 from 9 to 4
move 1 from 4 to 9
move 1 from 5 to 2
move 2 from 5 to 6
move 2 from 8 to 2
move 7 from 8 to 1
move 1 from 1 to 7
move 3 from 6 to 9
move 2 from 3 to 2
move 1 from 2 to 1
move 1 from 8 to 7
move 2 from 9 to 6
move 2 from 9 to 5
move 1 from 5 to 6
move 1 from 2 to 8
move 2 from 1 to 7
move 1 from 4 to 3
move 3 from 2 to 5
move 7 from 1 to 3
move 10 from 3 to 4
move 3 from 5 to 4
move 1 from 3 to 8
move 3 from 3 to 2
move 1 from 8 to 1
move 1 from 1 to 3
move 3 from 8 to 3
move 5 from 4 to 6
move 1 from 2 to 3
move 4 from 6 to 4
move 1 from 5 to 7
move 4 from 3 to 4
move 1 from 2 to 8
move 12 from 7 to 6
move 1 from 8 to 2
move 2 from 2 to 7
move 1 from 8 to 4
move 23 from 6 to 3
move 14 from 3 to 6
move 15 from 4 to 6
move 1 from 8 to 6
move 10 from 3 to 7
move 2 from 4 to 2
move 11 from 7 to 8
move 2 from 2 to 6
move 44 from 6 to 9
move 21 from 9 to 3
move 12 from 3 to 6
move 1 from 7 to 4
move 1 from 4 to 7
move 9 from 3 to 2
move 2 from 8 to 6
move 3 from 2 to 4
move 17 from 9 to 1
move 3 from 4 to 6
move 2 from 2 to 9
move 4 from 9 to 2
move 10 from 6 to 9
move 1 from 7 to 6
move 4 from 9 to 5
move 4 from 2 to 4
move 14 from 1 to 5
move 4 from 4 to 3
move 3 from 2 to 9
move 9 from 9 to 7
move 1 from 2 to 5
move 9 from 8 to 5
move 8 from 7 to 2
move 4 from 3 to 8
move 5 from 6 to 2
move 3 from 1 to 6
move 1 from 7 to 1
move 4 from 2 to 4
move 3 from 6 to 4
move 3 from 8 to 3
move 13 from 5 to 2
move 2 from 3 to 5
move 12 from 5 to 9
move 1 from 3 to 5
move 1 from 5 to 9
move 1 from 8 to 3
move 4 from 9 to 5
move 6 from 4 to 5
move 12 from 9 to 7
move 1 from 9 to 3
move 1 from 3 to 2
move 12 from 5 to 6
move 12 from 7 to 2
move 1 from 3 to 7
move 1 from 4 to 8
move 33 from 2 to 8
move 1 from 7 to 5
move 1 from 1 to 2
move 4 from 5 to 4
move 3 from 2 to 5
move 34 from 8 to 6
move 1 from 4 to 3
move 1 from 5 to 7
move 1 from 7 to 5
move 3 from 4 to 9
move 2 from 9 to 7
move 1 from 9 to 4
move 1 from 3 to 7
move 1 from 5 to 8
move 1 from 5 to 1
move 1 from 5 to 7
move 1 from 4 to 8
move 1 from 1 to 4
move 1 from 4 to 2
move 3 from 7 to 5
move 2 from 8 to 5
move 1 from 2 to 8
move 4 from 6 to 2
move 1 from 8 to 6
move 1 from 7 to 9
move 29 from 6 to 7
move 4 from 2 to 3
move 2 from 5 to 8
move 1 from 9 to 5
move 2 from 8 to 1
move 23 from 7 to 5
move 2 from 6 to 1
move 23 from 5 to 6
move 1 from 3 to 6
move 4 from 5 to 9
move 2 from 1 to 3
move 5 from 3 to 8
move 2 from 6 to 5
move 2 from 1 to 4
move 1 from 9 to 8
move 1 from 9 to 1
move 1 from 4 to 6
move 2 from 5 to 6
move 6 from 7 to 8
move 2 from 9 to 2
move 18 from 6 to 5
move 21 from 6 to 4
move 1 from 1 to 6
move 2 from 6 to 7
move 2 from 7 to 9
move 2 from 2 to 8
move 7 from 4 to 3
move 12 from 5 to 3
move 1 from 9 to 5
move 1 from 9 to 4
move 6 from 5 to 2
move 17 from 3 to 4
move 3 from 4 to 3
move 1 from 2 to 4
move 5 from 2 to 8
move 1 from 5 to 8
move 19 from 8 to 7
move 1 from 3 to 6
move 1 from 8 to 4
move 1 from 6 to 1
move 15 from 4 to 6
move 1 from 1 to 4
move 3 from 3 to 5
move 4 from 6 to 7
move 1 from 4 to 7
move 10 from 6 to 7
move 16 from 4 to 5
move 24 from 7 to 2
move 8 from 7 to 8
move 1 from 4 to 2
move 6 from 8 to 7
move 1 from 8 to 7
move 1 from 6 to 9
move 14 from 5 to 4
move 9 from 7 to 8
move 4 from 5 to 1
move 2 from 1 to 5
move 3 from 8 to 6
move 2 from 6 to 9
move 2 from 2 to 8
move 6 from 2 to 7
move 3 from 4 to 6
move 1 from 3 to 4
move 3 from 5 to 7
move 1 from 6 to 9
move 5 from 7 to 2
move 4 from 9 to 1
move 1 from 7 to 9
move 9 from 8 to 4
move 5 from 1 to 2
move 2 from 6 to 1
move 6 from 4 to 7
move 1 from 7 to 3
move 1 from 3 to 9
move 1 from 9 to 7
move 1 from 6 to 7
move 9 from 4 to 5
move 7 from 7 to 9
move 3 from 7 to 5
move 1 from 9 to 2
move 6 from 9 to 8
move 4 from 4 to 5
move 1 from 4 to 2
move 1 from 4 to 2
move 2 from 1 to 2
move 1 from 9 to 8
move 10 from 2 to 4
move 8 from 2 to 7
move 12 from 2 to 9
move 6 from 7 to 4
move 1 from 1 to 2
move 8 from 9 to 8
move 7 from 5 to 1
move 9 from 4 to 3
move 14 from 8 to 4
move 1 from 8 to 4
move 1 from 1 to 5
move 1 from 5 to 2
move 3 from 2 to 4
move 1 from 7 to 1
move 1 from 7 to 3
move 2 from 1 to 7
move 3 from 5 to 7
move 2 from 7 to 6
move 1 from 6 to 5
move 3 from 7 to 1
move 1 from 6 to 8
move 1 from 8 to 7
move 1 from 3 to 6
move 1 from 7 to 1
move 4 from 1 to 4
move 6 from 3 to 2
move 3 from 1 to 2
move 3 from 3 to 6
move 3 from 2 to 6
move 6 from 6 to 5
move 1 from 1 to 4
move 1 from 9 to 6
move 5 from 2 to 1
move 3 from 1 to 2
move 2 from 9 to 8
move 3 from 1 to 5
move 1 from 9 to 7
move 25 from 4 to 1
move 1 from 1 to 7
move 2 from 8 to 3
move 13 from 1 to 9
move 2 from 3 to 5
move 8 from 5 to 9
move 4 from 2 to 1
move 2 from 6 to 7
move 10 from 5 to 9
move 4 from 7 to 2
move 2 from 2 to 3
move 9 from 9 to 2
move 4 from 4 to 5
move 4 from 5 to 4
move 5 from 1 to 4
move 10 from 4 to 5
move 22 from 9 to 1
move 2 from 2 to 7
move 3 from 2 to 1
move 6 from 2 to 6
move 1 from 7 to 1
move 10 from 5 to 7
move 15 from 1 to 4
move 13 from 1 to 5
move 3 from 6 to 8
move 1 from 8 to 9

1
2022/inputs/06.txt Normal file
View File

@@ -0,0 +1 @@
grvrnvrnnjljbjqjpqjjvhhzwwrbwwbblrltrrpbbbbqnnqbbbbsvbvmbvmbbrsrqrzrllwbbbqzqrqnqrnrjnnjccdggwqqhrrjcjmjmllgrlglhlclmlvlvsshwwsggmfmdfddgdfftrrczrcczhzppgdgrdggghmmdwwqgggslglfgfcgccmjcjwjrwjrjcrjjsgjjvddpwpgpbbgwbgwwhnhfftbffhpfphhfqfrqfrfnfpprvrsrhrfrllfhhrsrhssvfsvsnvsnsswtwtlthllrjjwddtggzczgcchwcwppfbbdvdrdzrdrvrwwsbsfbssqfsfjsjcscttlztllgjjlbbdsdtssvvvwlvlqqnhqqtdqtddjcdcjjpbphhgtgtqtzqqzhqqtgtvtmvtvrvqrvvfmfmppzzbwwnddzttfpfrrlddbppfqppnwnswwdhwdwjjqljqqthtnhnddgmgcmgcmgcmmfmfttrzzfdzztllmjlllgcgbbcqcvccpnndbdjbjmmzbztzptzpprpddptpprhhvlvmlmpmmljjnnjsjfjjvgjjvzzfgfzfbftbftttgstgstgtpggflfcfqqtctltgltldlzdlzzmmlddnvddzfddppmnpptzptpvttwstwswvwrvvbfbjjjbmjjdvdvrvdddrwrhrzrqqhghhrwhwhrrmppsgpsgszzdfdfwwmtwtvwvgvffmqqqtqntqnnjcncbnbwnnzggrdrqqjbqjjwjqqqwlqwlwzlljhhfsfsqsrqqhwqqwbbqbvvlflrrlglbbjhhjmhjjcmcjcgczcfcgcqqczcnnvjnnlddmpmcppgvgjgddvrrnsnmnqmqgmmnppwgwcgwgssbddgtdgdgmdgmgvvmjmvmjmvvsfssdgdghdggbfbqbdbjbsbmmrpmrprggbllwrwpwtppzvppzsssdnsdnnvnhvvvzvfzfqqnnmlnltldtdvdbdblddsmmlccmlmvlmvmmcsctctrtsrstsbsrshsddlmddmppgsscttnrtrqqcvcwwlnlznnnvcnvvtnvnbnmbmvmppjgjdjtddmpdmdvvmgvvdqdlqlhhzccsggjdjsdsttctjctjtfjttppdzpzzbjbwwmwbblslzslzszlzrrcbrrfggvcczjjtbbdnnggbwblwlbwlwqqfvfqfddrrfccvlllhmhhhrthrthrrnbnzbbpzplphprrrnbbghhnshnhbblqqqvwwffnmnmhhtccpqpvqvbvnvvfnfsnffdjdllwffcddgcgrgjrggchcpcddtbbdtdmtdmmhhtphtpppclcpcvcjvcjjfqfzqqphpnhnrnhhpdhhtfhhbbmqmfmsmvssgqqfssqgglnnqmnmbnmbbllrdrgdrdvrdvdsvvnddgtgddcdqdsqdqbqqlhhwdhdgdcgcdchchrchhpvvpgvgrrfggwfwgmpddbhfngtrwswfszgsggnpsntjpslrpjqsffzrlnbnzdtqpqtjzwlhhgrsrbvnccnsjmzcbqgcbtbqlzhnpnhhrrvqwjwzzvrlcrmjhcscrqhpqmfzbnvcwwqhcjjlnggmpbwztzfswmsbjshnsgfmdlzvzczhrdwgwbghszpnbfpctrshbfhspsczcqcrrqcpwwpfzhjqtpqgjbztrpzrlgfdjbmlwdvlvnfmdzbwsbbhlbszvwcpztlchjrqbmsftltmqpfgdpmdgjvwqqtjsqlfqrwmsnlqgsbqfwsdnfvzthmbplvszfcmlptlcjpnfpjsphsmmjplwjqphgvzbtbjtpttqhlwtgnrjvmvsfsztmsqszzlhqqhfslsvhzgtsssfctzgsqbgdzlpwbsmpcnjqshhhcwqdsdzdhnjfqzqnqdlrpddcgrgldgqbjmdtwgppdczzrjvmcfqjbpjzbtjmgdphlbwnsnpfdqlhwvvmpwzsrztnwvtlbphljmjwsgbphgmwhdmfhpvsmvsjccjhfvqtvfmmlnggncltvtrgmbtfqsvfnlvcmjnjwzcrpjnsgntvhjbtdlptshbhhchqmsprhqzdnfpjqccdfvnzjtlbsmmwvzlwlvmsbrnhqctvtvbfhntdctjnrbcrrlmsnwbbjbcbbgrrhfqwzwwfgvsvgbwnttghtgpspzwzfhffsqjvwwttntnvlwftsfvtttgnprzrzsghvjrdtsfdvzswhmrfcdqsgvrlhzbnvbmjlqrftnnbtwqtvlvwznfbslhdqjbntdgpprfqchjvgvzjssdztjlzwfljjmfvzrbbtczggzqwrnqqgzzcbqjcpfqfrbwtdjrrvbszsjdjcpdfjscsvnltcgwvqsgnhbfgnfnddnpmbzbptrmvqzpvbdpfdvtlmgnnjwflgdbfnmvsdnmlvgcpwflwvdbtbfwtfpsmqsplnzwlwgvbjrhghwrnrswsggbqpdjcjrgbgnsqdvwzzwftvjqgjzzcdvpbbjzpphmbcqmrjvgqwfgrsnqvhwflmhgrlvbpwdcsrlqwfrwppqbrdhwqtvczpclpsbsjcptgblbbsqmbhjjgzwvlcnhnzcttmpjsgchmppgphqlzlcsqcgbbjgtjjvmttdztfdptzgvmpnqrcmpmcdlpnbztllvqbggqbqhlqvdwsrwzsjwfrqvcbvsgfdptmrzpvdfblmhlzrvpmsljlqqzrhlnmwncpfhvqlsbtrjbfcrnfvjvddrhdbbczjdsrdvzlbqrccssdzcpmdsqbprjppfzdwfdswptgzcmjqfhcwsqfqhvrslffqfbcvhdzljzrmtwmfdwzdhhjcmbjtvjhzzwfqhrcslztdbnlwmmhbbbgdscjcdzftnchqfnflnsdqjscfrqpnfbftpzvtmrwncqfqqflschpfnjsjlqcjdjgtwpqhgcnjdmnnvmmpwdspmnrgqrptqwcvbtdwpqlbtwpqgwgfrzlrhtvrvzhmhmwhfdsrhpcczqfltsgtgrfwcvlcvtlhqqwnrqgzpnzbfmzbdwqwbsfvbshrgzqdbgvrhzhzlbqsfzttmsnmrqmwgtzbvdqdrbgcpclzjrhdbjtpcdbbznjgtbwbqrnpvffdmwtrbhhstcmnjcwbbnmpbvmjprtzgcptmtrffwhvfgdljnrbbrblbfbgdwtjrtgqgrpvpgjqrjzczvvlspgdbzftqgqvgdqlglbgvgjdcztznszcwfqhmwbrbjcfstzdcmdsssqfhtzpdgmzjscvbdzgbhhgdqgvfwrzmhdrhlsvlzjjzbzdljcbhncppwrtptjgszlqsrqpzqcsgvdvzmgvwgsncnbffttslphcstqvfwbwzbflmshcbnhpljgqwmmwwzlgpbcqnrtqlwcjcrclfdrnnmvtbfdztdfvtqrsgdptfcfpzpsldhzmrngggfvdqggtlfqqwsldprcffsstnnpmsbbvghdbpprqbssnprdbqclzqtgsrczwcvqwrrfmmfwsndvtvqljwwglrgbphdvvwgctbbmtrbpzqtspgrlhmnhjcdwhwvssgspzjbcfjttjqbdpdmptfzzjcfqljpqddfssmffqprvbptfvdshsdmfmdtmlbnmbmjjjsgmlmwmgcwhbrbgchrstptvdlqgddfzddlzhwjmsvvcjwvqtzjtsctfmzchlbrvlgdzbvdlbfpvhptpltrdmcgjghcpwvwqqnrzdtnmgdncplhdpsgpnbprbgshffwwsdhpgqsbmwdtpnhhltlcqfrjtswcchzvlhdgrmjwhgwppdjqlgmdhwbllqvzrchgclmqdlghjsvmwlflmhhmdzbfjhjnvwphnjbclmdpgflqgtfsmsjslntfcmtbphnrgpdcqtjzjttdtgjmvhzsrfnrjqssvwpcslpfstbpfsrsntmftmdgsqrrsnddqfmchrhtlhmqndvvllnvltdzfphjqnvmcdsgfpcmjftgdpntjzplqljhtthvnbzbzwvfnqsjvnfwhmtbsspjslgfjvdgfjpwrsgqwntntjcqtdgnhnsfwhhqfwbwhdrftj

983
2022/inputs/07.txt Normal file
View File

@@ -0,0 +1,983 @@
$ cd /
$ ls
dir gqcclj
dir lmtpm
dir nhqwt
dir qcq
dir vwqwlqrt
$ cd gqcclj
$ ls
62425 dqp.gjm
174181 hrtw.qsd
273712 pflp.mdw
169404 zlthnlhf.mtn
180878 zprprf
$ cd ..
$ cd lmtpm
$ ls
dir clffsvcw
163587 cvcl.jqh
dir dcqnblb
dir dtpwln
dir fvt
dir hrcrw
dir jdqzmqn
236754 nrdmlj
205959 pflp.mdw
dir qcq
dir rsn
129926 vdgcqdn.sqd
dir zprprf
$ cd clffsvcw
$ ls
6997 dcqnblb.wbh
145711 dqp
159225 pflp.mdw
$ cd ..
$ cd dcqnblb
$ ls
dir dcqnblb
dir gfn
dir lpswsp
dir lvt
dir zprprf
$ cd dcqnblb
$ ls
2020 grpdmd.ggz
dir zpswzfvg
$ cd zpswzfvg
$ ls
206998 zprprf.gnw
$ cd ..
$ cd ..
$ cd gfn
$ ls
277530 rhbvtblc.mvw
$ cd ..
$ cd lpswsp
$ ls
173180 dcqnblb
$ cd ..
$ cd lvt
$ ls
dir hjllwsvl
dir ptbt
$ cd hjllwsvl
$ ls
dir wqnc
$ cd wqnc
$ ls
64695 grpdmd.ggz
$ cd ..
$ cd ..
$ cd ptbt
$ ls
150880 vvbt.gtp
$ cd ..
$ cd ..
$ cd zprprf
$ ls
dir ldzslndn
dir qftt
$ cd ldzslndn
$ ls
dir bwqqsbhg
129454 vbn
$ cd bwqqsbhg
$ ls
108701 zprprf.gss
$ cd ..
$ cd ..
$ cd qftt
$ ls
64268 cvcl.jqh
$ cd ..
$ cd ..
$ cd ..
$ cd dtpwln
$ ls
196215 cvcl.jqh
dir dpwg
dir ldzslndn
dir znnsqqh
$ cd dpwg
$ ls
192388 gmh
47754 grgzh.qdl
99449 hqsh
dir pbmf
50061 pflp.mdw
192902 qcq.pgg
dir rmpvj
dir scgc
$ cd pbmf
$ ls
210083 wpfnwbl.mgf
$ cd ..
$ cd rmpvj
$ ls
125738 nmlnbvrd
226214 zprprf.jnp
114257 zprprf.srs
$ cd ..
$ cd scgc
$ ls
182115 rrc.rcc
$ cd ..
$ cd ..
$ cd ldzslndn
$ ls
201992 qcrm.cpd
$ cd ..
$ cd znnsqqh
$ ls
85635 cvcl.jqh
$ cd ..
$ cd ..
$ cd fvt
$ ls
dir dcqnblb
dir gnc
75864 vfn
$ cd dcqnblb
$ ls
dir dcqnblb
dir lbnflwsh
$ cd dcqnblb
$ ls
269901 cvcl.jqh
$ cd ..
$ cd lbnflwsh
$ ls
33336 grpdmd.ggz
42861 phg.wmc
$ cd ..
$ cd ..
$ cd gnc
$ ls
dir jhjbjsp
dir jjppr
$ cd jhjbjsp
$ ls
96177 ldzslndn
$ cd ..
$ cd jjppr
$ ls
181016 dqp
$ cd ..
$ cd ..
$ cd ..
$ cd hrcrw
$ ls
261376 dtjfpppr.dww
54658 vsrgvw.pfn
$ cd ..
$ cd jdqzmqn
$ ls
52342 dcpndc.vlg
171946 gggpchh.tbb
dir ldzslndn
11156 nbfrfvv.gzw
$ cd ldzslndn
$ ls
107873 cvcl.jqh
216034 gfdjrbz
68844 pqllfrrh.jcf
$ cd ..
$ cd ..
$ cd qcq
$ ls
152886 ldzslndn.ltn
105125 vwplh.vbf
$ cd ..
$ cd rsn
$ ls
15385 hqcmjdgv.jjv
105735 qcq.bzg
58805 snczcsp
26668 vbn
$ cd ..
$ cd zprprf
$ ls
dir chbmq
dir dcqnblb
dir dqp
dir nfspb
89506 zprprf.hnt
$ cd chbmq
$ ls
dir cnjvw
dir dqp
151434 frsvrdnt
dir msztjvcb
240689 qcq.jlh
dir sjzrcg
97312 vnr.zfr
dir zprprf
$ cd cnjvw
$ ls
dir bpbs
252403 cqhtshc
dir djmjhn
10935 fhqmswr
6582 pdwml.ldd
dir qcq
219282 rfmd
$ cd bpbs
$ ls
147582 bnhwsnsj.gdm
61362 cvcl.jqh
152857 vdgcqdn.sqd
$ cd ..
$ cd djmjhn
$ ls
dir bjdbcjbb
dir dcqnblb
dir dqp
dir lgdwtt
$ cd bjdbcjbb
$ ls
110710 cvcl.jqh
252792 hmshctr.lgz
dir mjhtmbj
189745 shsswcgr
dir tfnhp
194940 vbn
dir zprprf
$ cd mjhtmbj
$ ls
dir dqp
dir hbthpcmb
$ cd dqp
$ ls
200832 sbcrz.qgw
$ cd ..
$ cd hbthpcmb
$ ls
55191 ffcntg
$ cd ..
$ cd ..
$ cd tfnhp
$ ls
276825 dqp
161538 gqmr.wgb
$ cd ..
$ cd zprprf
$ ls
287638 dcqnblb.ssp
41274 hgmrvj.mwf
249118 sbb.gsf
105141 wwrg.gqz
$ cd ..
$ cd ..
$ cd dcqnblb
$ ls
1957 btmmc
32386 dtzbzg.dhm
dir mmrbj
98283 ntmhfgtl.pmf
dir zprprf
$ cd mmrbj
$ ls
273194 wnsq
251527 zprprf
$ cd ..
$ cd zprprf
$ ls
27678 ldzslndn.rrl
62866 ljf.fdj
148502 qcq.dlg
dir rvgqvm
179231 tllnmhn.pjp
64033 vbn
dir zcdrj
$ cd rvgqvm
$ ls
dir ntbv
262324 prhgj.szz
dir qbvdh
$ cd ntbv
$ ls
116608 cgv.fvj
175200 swpswq.twt
$ cd ..
$ cd qbvdh
$ ls
160353 sdhfrb.wjn
$ cd ..
$ cd ..
$ cd zcdrj
$ ls
283262 ctl
$ cd ..
$ cd ..
$ cd ..
$ cd dqp
$ ls
dir jfzm
111438 rdrgb.mjf
64194 wgtmqrq
dir zprprf
$ cd jfzm
$ ls
158774 pflp.mdw
$ cd ..
$ cd zprprf
$ ls
215264 sgsstcp
$ cd ..
$ cd ..
$ cd lgdwtt
$ ls
dir qcq
$ cd qcq
$ ls
165461 ldzslndn.vvb
$ cd ..
$ cd ..
$ cd ..
$ cd qcq
$ ls
dir dpd
165044 grpdmd.ggz
82343 ldzslndn
dir mwg
176689 psjcwp.wct
44404 qcq.zwd
$ cd dpd
$ ls
84087 dqp
227386 zprprf.gfs
$ cd ..
$ cd mwg
$ ls
214086 pflp.mdw
dir sjjsdn
225859 wcdt
158892 zprprf.frs
$ cd sjjsdn
$ ls
260121 gplgp.dfn
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd dqp
$ ls
dir hcrwclpg
dir zphd
$ cd hcrwclpg
$ ls
dir cmqntjj
16393 ldzslndn.qbm
91152 qqdtc.zdq
$ cd cmqntjj
$ ls
272266 ldzslndn.pll
$ cd ..
$ cd ..
$ cd zphd
$ ls
165711 chftwcsw.fqw
256871 cvcl.jqh
251168 zprprf.gfv
$ cd ..
$ cd ..
$ cd msztjvcb
$ ls
206231 brzn.lmn
dir dcqnblb
21571 dqp
dir fmn
45779 mlfctz.cjr
288827 pflp.mdw
220578 qcq.fqf
$ cd dcqnblb
$ ls
198121 ghbwgs
93681 nmqhl.vpq
$ cd ..
$ cd fmn
$ ls
29407 mdfws.qvs
$ cd ..
$ cd ..
$ cd sjzrcg
$ ls
155120 ddclvsjr.rpq
136029 ldzslndn.dcm
dir vhzh
$ cd vhzh
$ ls
212446 vbn
$ cd ..
$ cd ..
$ cd zprprf
$ ls
240335 crt.gqh
185363 gnmm.qgh
dir ldzslndn
dir nwl
dir qll
277043 vbn
217796 vtvgpdl.vtm
$ cd ldzslndn
$ ls
273570 cvcl.jqh
68510 fgdmz.hrc
dir npq
dir swjrzzrm
$ cd npq
$ ls
97923 dzcjsqwt
$ cd ..
$ cd swjrzzrm
$ ls
180599 tmpgn.bjf
$ cd ..
$ cd ..
$ cd nwl
$ ls
171833 dlwrfhh.qgn
$ cd ..
$ cd qll
$ ls
219926 dcqnblb.bvn
$ cd ..
$ cd ..
$ cd ..
$ cd dcqnblb
$ ls
dir lvpb
276198 tbgcm.qct
$ cd lvpb
$ ls
142590 bvhjlld
268259 gnjfg.sgb
dir qcq
206220 qcq.zsg
258137 rrsw.dnb
dir tmr
215549 vbn
$ cd qcq
$ ls
dir mmpgd
dir tdsz
dir tmfvsjwc
$ cd mmpgd
$ ls
70793 jwbnpwnn
$ cd ..
$ cd tdsz
$ ls
246310 tdvrhhg.bzq
$ cd ..
$ cd tmfvsjwc
$ ls
103899 grpdmd.ggz
287850 ldzslndn
125930 llhr
$ cd ..
$ cd ..
$ cd tmr
$ ls
83344 fbtfcg.hqp
$ cd ..
$ cd ..
$ cd ..
$ cd dqp
$ ls
dir lbgmcbv
dir nbg
$ cd lbgmcbv
$ ls
81776 wzdzzdp
$ cd ..
$ cd nbg
$ ls
dir mfsgjp
155574 pflp.mdw
$ cd mfsgjp
$ ls
199400 vdgcqdn.sqd
$ cd ..
$ cd ..
$ cd ..
$ cd nfspb
$ ls
262412 csrdtbs
73867 vbn
136389 zqps.hjt
$ cd ..
$ cd ..
$ cd ..
$ cd nhqwt
$ ls
123766 cvcl.jqh
dir dhrtvctp
222086 grpdmd.ggz
dir gzg
26005 lhpmz.tgz
dir mcnjwwfr
117122 msn.gst
$ cd dhrtvctp
$ ls
224079 vdgcqdn.sqd
$ cd ..
$ cd gzg
$ ls
124395 dqp
dir wqdbtqm
$ cd wqdbtqm
$ ls
237354 pflp.mdw
212019 vdgcqdn.sqd
$ cd ..
$ cd ..
$ cd mcnjwwfr
$ ls
92504 cshdztf
dir dctl
dir dqp
dir flcrmhlj
161879 grpdmd.ggz
dir gtt
dir hlbnhchz
220093 mdtdsgvm.zgg
dir twntr
287192 vbn
$ cd dctl
$ ls
dir bbhch
155396 hrrj.jzm
164971 pblqmwj.vdb
dir wnlgfpvf
$ cd bbhch
$ ls
dir dpqtp
dir jvdrcw
$ cd dpqtp
$ ls
174135 gwb.qrb
$ cd ..
$ cd jvdrcw
$ ls
215993 dcqnblb.cqp
200800 stjttf.ngc
$ cd ..
$ cd ..
$ cd wnlgfpvf
$ ls
135978 cvcl.jqh
dir dqp
54018 lbrfmt
$ cd dqp
$ ls
270516 dcqnblb.jqw
dir dqp
144626 grpdmd.ggz
157731 hvcv.rhp
133773 lnnt
76250 vdgcqdn.sqd
$ cd dqp
$ ls
41504 zprprf.cmc
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd dqp
$ ls
dir dqp
dir ldzslndn
236737 mqzcvm.fjh
239746 nhcdz.ncj
dir rpchqq
248824 vdgcqdn.sqd
250937 zrchht.mwg
$ cd dqp
$ ls
203381 qcq.djm
$ cd ..
$ cd ldzslndn
$ ls
dir dqp
dir fptnzlv
dir gmbnpm
dir vhvblt
$ cd dqp
$ ls
19579 qcq.lhg
$ cd ..
$ cd fptnzlv
$ ls
209930 dcqnblb
$ cd ..
$ cd gmbnpm
$ ls
dir ldzslndn
dir qcq
$ cd ldzslndn
$ ls
11075 pflp.mdw
$ cd ..
$ cd qcq
$ ls
dir tdp
$ cd tdp
$ ls
40741 vdgcqdn.sqd
$ cd ..
$ cd ..
$ cd ..
$ cd vhvblt
$ ls
dir lzr
$ cd lzr
$ ls
62245 gbnj.llg
$ cd ..
$ cd ..
$ cd ..
$ cd rpchqq
$ ls
dir bcs
dir dcqnblb
dir fvjzn
dir lrphzrv
$ cd bcs
$ ls
179794 bbn.dzb
242069 cmjdmzjf.zgf
1703 cvcl.jqh
dir gnmhwj
dir ldzslndn
152520 qltpsz.jsj
dir sqqjfps
$ cd gnmhwj
$ ls
dir gvs
201600 hptn.ftf
dir hzrnb
dir qcq
dir sqhl
$ cd gvs
$ ls
152358 zprprf.mlh
$ cd ..
$ cd hzrnb
$ ls
94290 gplsfd
$ cd ..
$ cd qcq
$ ls
91909 vmqd.bmg
$ cd ..
$ cd sqhl
$ ls
238673 vdgcqdn.sqd
262885 zmdvr.nfg
$ cd ..
$ cd ..
$ cd ldzslndn
$ ls
240461 mdz
84303 qtj
$ cd ..
$ cd sqqjfps
$ ls
88753 fwn.tff
$ cd ..
$ cd ..
$ cd dcqnblb
$ ls
dir dqp
189996 dqp.pvp
$ cd dqp
$ ls
dir qvfjz
196506 vbn
$ cd qvfjz
$ ls
209316 pflp.mdw
107459 rwpbh.vpt
$ cd ..
$ cd ..
$ cd ..
$ cd fvjzn
$ ls
241464 cvcl.jqh
dir dqp
dir ldzslndn
dir msp
125 pflp.mdw
131895 vbn
$ cd dqp
$ ls
34019 pflp.mdw
202957 vbn
$ cd ..
$ cd ldzslndn
$ ls
147492 cvcl.jqh
248719 spc.rfv
$ cd ..
$ cd msp
$ ls
184407 cvcl.jqh
$ cd ..
$ cd ..
$ cd lrphzrv
$ ls
dir bbwqmbg
81858 cvcl.jqh
dir dqp
248670 gqqsww.tsn
199141 grpdmd.ggz
dir ldzslndn
34514 ldzslndn.ctw
dir tln
214615 zprprf.fwm
$ cd bbwqmbg
$ ls
129750 flf
dir pvlw
dir qcq
126 sqcqphz.tbm
$ cd pvlw
$ ls
198005 jfvj.hdv
$ cd ..
$ cd qcq
$ ls
dir wgdzws
$ cd wgdzws
$ ls
253522 ldzslndn.qwt
$ cd ..
$ cd ..
$ cd ..
$ cd dqp
$ ls
281993 cvcl.jqh
dir hwqjlwcb
50532 msccz.qgm
102187 trv.tnq
111 wplnmj.bfl
$ cd hwqjlwcb
$ ls
267580 dhjqb.dsb
153195 ldzslndn.jqv
41526 mvwcwc.zsc
$ cd ..
$ cd ..
$ cd ldzslndn
$ ls
58666 cvcl.jqh
79950 dqp.tmc
242217 hns.lrb
dir njswzh
240692 vdgcqdn.sqd
dir zvmjvcdm
52909 zzh
$ cd njswzh
$ ls
149732 cvcl.jqh
dir rnmfd
$ cd rnmfd
$ ls
75368 dqp.hmv
14350 vbn
$ cd ..
$ cd ..
$ cd zvmjvcdm
$ ls
dir jgczt
$ cd jgczt
$ ls
dir qcq
95941 qzvvwshv.jwc
$ cd qcq
$ ls
273942 pflp.mdw
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd tln
$ ls
dir bmcng
1518 lrg
dir vnjfrhp
$ cd bmcng
$ ls
38917 fqcrt
$ cd ..
$ cd vnjfrhp
$ ls
dir dcqnblb
dir dqp
247186 grpdmd.ggz
dir ldzslndn
169216 pflp.mdw
206487 vdgcqdn.sqd
16976 vlsrzjmb.mmc
257938 wjl
$ cd dcqnblb
$ ls
dir dqp
$ cd dqp
$ ls
184133 qcq
$ cd ..
$ cd ..
$ cd dqp
$ ls
dir dcqnblb
31612 dqp.pnt
212283 ldzslndn
61600 vdbfc.ddj
197189 wpv.wff
$ cd dcqnblb
$ ls
62412 tfzllmrj
dir zprprf
$ cd zprprf
$ ls
dir bqnpsl
dir dszrvpzc
$ cd bqnpsl
$ ls
261548 spbsbbsw.cmn
$ cd ..
$ cd dszrvpzc
$ ls
188232 sggpqslr.smn
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd ldzslndn
$ ls
dir bgnhd
dir pgvcdzwz
dir qgzhm
$ cd bgnhd
$ ls
56989 cvcl.jqh
$ cd ..
$ cd pgvcdzwz
$ ls
110034 qhgnndv
$ cd ..
$ cd qgzhm
$ ls
247232 grpdmd.ggz
269292 ldzslndn
153843 tpz
dir vnschqwr
162392 wnq.btb
$ cd vnschqwr
$ ls
43005 fvtvzfqm.jvc
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd flcrmhlj
$ ls
245668 dcqnblb.sdj
dir lffj
229909 pflp.mdw
280176 vbn
$ cd lffj
$ ls
116451 jmzz.jdd
dir pjlwb
162815 pmhlqq.snr
226183 zffth
$ cd pjlwb
$ ls
67518 qcq.hjq
$ cd ..
$ cd ..
$ cd ..
$ cd gtt
$ ls
52105 grpdmd.ggz
126869 zprprf.fgj
$ cd ..
$ cd hlbnhchz
$ ls
3064 dqp.lrw
278756 grpdmd.ggz
177208 ldzslndn.wlv
141685 vbn
$ cd ..
$ cd twntr
$ ls
63747 cvcl.jqh
$ cd ..
$ cd ..
$ cd ..
$ cd qcq
$ ls
226858 cwblp.zgp
dir jjqsmfhr
dir rjbqtrq
dir vwmpnbts
141715 wdbhdch
286381 zprprf
$ cd jjqsmfhr
$ ls
dir btmm
dir fqndtlgq
$ cd btmm
$ ls
4031 dqp.lrr
dir fzdd
$ cd fzdd
$ ls
dir vnwpn
$ cd vnwpn
$ ls
dir bzlgsl
dir ztvzrrbv
$ cd bzlgsl
$ ls
9294 ldzslndn.sqr
$ cd ..
$ cd ztvzrrbv
$ ls
256017 cvcl.jqh
$ cd ..
$ cd ..
$ cd ..
$ cd ..
$ cd fqndtlgq
$ ls
271528 ccbmgp.bwd
$ cd ..
$ cd ..
$ cd rjbqtrq
$ ls
122150 ldzslndn
46467 tpdvp.pjf
$ cd ..
$ cd vwmpnbts
$ ls
47518 fcrwfzvm
263343 gmc.lrt
212764 qcq
$ cd ..
$ cd ..
$ cd vwqwlqrt
$ ls
dir psrs
$ cd psrs
$ ls
281998 zprprf.hml

99
2022/inputs/08.txt Normal file
View File

@@ -0,0 +1,99 @@
133120320210233440424211425033311533112110111336536142004454550513525522325223123404213204010312200
201131111014211324423255354022022243226445013613610423653614522135534505055120330313403031333103010
312033232323231244025301315245341424106564334260061464515142114141551050411122254121204214442432210
101223224313414001513045124413405604251532415616200623342234245060512030200002055453441222043022132
302000022010423415300513533001221654231646352603366222420353100303160621313144421120541324031322221
022041343104313414435021243154525050055065506466215004364316065443031303052541012204020300331224312
103341401201343234101335152026143021665443260024145323023321363412215203352344024010350241320230403
113420142141151035404302242616255522460104100534576523546245441245051223305614204355454223220120301
141313120334140413444311032422155464031057323373712672513175353623531154646460010504312302300002224
222122233241135333145102102244620325637577115357373355166254434732406430504542404102101335430322111
303334221050505214133200215501142243567431213624743475716112467711442460620524310041114411011423020
314200333004550151023253063621162447552734266222424315622125733562141045411643325165010440012411104
002041023423222500521530364652321342767176666734452465675417573276212213343035032650010252311440041
424112310115314154624123026322722176144615437667237551164455332134452657635041110204303331153310423
403331525242111322464321027125164326531546671615634451453753666614652523355664316050035035431040223
043240150545010061116502263626227235517673287377662722735257631252161774623714640414211242003124031
120153432445266666010553121747235535567222344854553227754373283562766712275433030145041514430322020
130205252451225625553367153422361135376345652238658565468884466665635712475577163231554521534443142
111112125502543266131422234726554665525278247588365447865236325776254766323137341434403365242323513
303144132003506154604725457356146262354554756268227328243768455722852644644163423635454133132303535
355321430425362320027571672735837582654822875282477453446323242873743335342262324741355251635040132
134315335666154514547724226424352647855667536237263286847676436882327536177762242121655513144251300
540433012152253201644772517187257277883368828477658659796427367852347254442546347411045431414354124
123440236041532033152645165666552487887293658447738333978367787858534683322123676621510536503333401
513523462114216537146475772264724378429935336847846348444575554346687726237537112655265045664650022
152254463440132245722174776775434287876777476649865634494799993998688326736773121545343121065304241
250224151321236513227671833576566739347663376834388478944395578563955424353347453672417622666244155
515223301360505722213752783545553644495694566664938776366634393433784855746658113613537562051065554
554241245610333147211334537367835857366454575934899676895788946595666473766285253431355325406031452
100314521636253352672223432738853968767459797559486648888395749643933624738538781345525612342532041
341462234622615555235573736647638675877393747847457878744844899855446378852378466172227414636330202
345125124225634624432677378235488673587578945954767695474694483979633396738646725252521775306550112
413420352557414334236458423883348897736674897485778466695756868398399557654674634472471146623221025
251143521254271126368347667353953675589776644454498798849645686658369675764886773874127564444411365
221413142252611772737673846553885549867478965666795885777985495763559573589863845361134756354652555
243065641366675316826485533843887969469458797465896675796454946875597936434758642384462157714462066
520553502161266638252882759578566955579648578498775589886979787578896857766344736358531725733564135
424035430516117723442423478595343855468789497988556567558494878666699996375768427758374271236421335
252313015177661777278432468494855844559656687766987679695575558744879656544795683583262246546564621
066230444571526644743382974447835556985988567697575656976987588986595376466888728567376162756500435
466346066733165454546438886894789699679455689766757985688888664759568963398874674733715475614334101
325014552177542688745486585579599747867559596676796865787567755944786444539663262282351475561402534
241163303516225237353826934978454869995779765759887659668665685578986859343646684568651136735352562
450361264326612736655359595445797648876877955597997887987765775498545883744548752574473726565411112
554605215356217343577344399893857478777797855566878769757669857854854856357865565536552164136515351
526446641376374684266375494495458695869978975788699978669887967564769488567376982882762633361324360
131314671231526545866684867949989786895865986986978678997899677764988874736369482822342624761635224
623254034413371684428636874768586849979569867987768799666579796798469744978968758623884477174221325
451620621666445477562568544366499474968796999686779676678989576768596484478933764745243527321126622
454130052341168772645439448775675586969558878998779766779998798589986885955369648636673756137543515
052463667567627485865289577459895546659595768687867979887989666587865576357344373227477771625616331
460630633631764266522893997758984967975685969969798677679989558694657986684466928784764257141450213
624130637644652532575536775488944945689777797679988979876565896659695947897698966634635115577122034
312106635521463635433584476586795448766769568869779667989675669974989668369378542526764316562641343
162151455625714643563689555468449898859656786796979798687579985864586658783373657585741615177725655
522113305657225658843435489885646557577988797667968888669868768989959977879557377455733555272325032
304510566333111422674633384687874565587979787768979689685867565897484896499888736286384551117254613
501463041455354857783745556844585568845776985978966685877875599798784456633539465754543114144204310
033044042511137887672349889484876755578886688778959586777755687684946795536886522746575472552603266
506221035322726455557224463853355996897775558969955685797667999588974556935495475632746634441041151
433136161743725565262636565676447685475989796568778598958657768879849778786859753335661722543205305
265454361556653132263478888989675487694888975877759959776785674478666588788563747772733262666414514
052441631644734262283652379957577654769979687765967795697668686969788694345962866843241632716655446
236003436545632166356247457495793686988694668988898785686844466844799668333966735544674562633412352
521460600027621624875854349394389587767654998655578976768847769685597639387383648267451531624063352
342222114334344716267243334967869638699594976567878976765649455495834476654882454551336614731204621
033566313156263553885434364795389663465876465857797479766958478858465479967473865454116236530266023
312652012603144155543338267594667756579949844587785799854455597889659839838335338227724422251205254
300006533237512225736566526838475448787546947968579975977675656694697397732838257677271224106345603
133143326544516157647526755363599347754745759889457964588954897669586537634253625642342472416641244
154255220262671713413357272553997888597745494647794956965689397737688378433337485552276212554465555
100240040401314462336283253854484757937369955476776566463546476496874852334852883176722554655020500
114224164252562264455188387248845988369836588899857935337746669656565572827235667727764740332042104
210035410165643165676172383567428973379998596753776399638478657839665546428878531777515004325230423
210124643010215635561443542385838474565467799589387569934754637575772733563765332372676641151131504
302221012422133674231332744234367852633548864367379437949776375866557752335873376756770315423300102
332125266633066263556242566636554222886478446383395355568773939525563625678526672212234343222625410
025325451166410144267526457225543863563576656495967865696633785745578788783545643421165350000423343
002055431510265615765734547166486528454663847694453963495886284323368575223225414276066312104153401
355245141260142612771253626632378444477523462347872628387736452238277834561572523626005254261254042
203545210065351052363237141625823577635472367448676276452678742864237273162112414622640501555430121
335510044411666505051763342712375473385677658477545568853568734655885763312211631300144242225254322
420503535251235101224431771412136627846753333256668624663675776462422374227471570160056336045543305
311442220344522144201454355125161416822475756464544562823568565277363143626236634605524051151344323
221042430004563020306242752654674353744234455564453257548654537765566764222366445225313642034222311
410315020300414623613025143245525766347157877736466252545465214236744364172443246502214503112203230
342304354225251006345461616171626576425171512572743837515273314522745717111151266035240243530314400
101402542354002125435251304674647534521162334775342133371111747561164265140621412560624450505304430
011211315525203435452400223603127166746242764515517634515312173434163762164444142306041434112503201
312201041521122523410120106532007714457744313215145447526753371116262403622123305243410143403304001
420143230433241404304622552610552657576751252637557577175144676122663421114064036341501055504120312
321114124142324224151525015553652243236362311234247651266113535462142056365353412114023231401141232
144010233331150422332523034411415500511027722375253755262514425243333354512150011301540445044301243
321223141143321313415515024451144622413543514327723454716501265226013550620005111202312303242203422
220312222242043544521300416060642531526303363025212311016020154415132623214322110011054242222314401
120043213410140522500232142235034335033562221102412305131143065020436150033340525535242031300403012
333011210021031104353104420453564321600565055235040060414452305642301521213234000231332120021102311
213000422032423433105500120521112552552162045443040565055142555024614151234210022135411312102303010
311113213314300134505043355233124354500023350433035532626242646113034040102425400244311432332422101

View File

@@ -1,6 +1,7 @@
//! Common helper utilities to all days //! Common helper utilities to all days
use anyhow::Result; use anyhow::Result;
use nom::combinator::map;
use nom::error::ErrorKind; use nom::error::ErrorKind;
use nom::error::ParseError; use nom::error::ParseError;
use nom::Finish; use nom::Finish;
@@ -92,3 +93,26 @@ where
} }
} }
} }
/// Add an index to repeated successful invocations of the embedded parser.
pub fn enumerate<I, O, E>(f: impl Parser<I, O, E>) -> impl FnMut(I) -> IResult<I, (usize, O), E> {
let mut index = 0usize;
map(f, move |v| {
let res = (index, v);
index += 1;
res
})
}
/// Return the minimum and maximum of two unordered variables
pub fn minmax<T>(a: T, b: T) -> (T, T)
where
T: PartialOrd,
{
if a < b {
(a, b)
} else {
(b, a)
}
}

View File

@@ -1,9 +1,86 @@
use anyhow::Result; use anyhow::Result;
use nom::bytes::complete::tag;
use nom::character::complete::newline;
use nom::combinator::map;
use nom::multi::many0;
use nom::sequence::separated_pair;
use nom::sequence::terminated;
use nom::IResult;
pub fn part1(_input: &[u8]) -> Result<String> { use crate::common::minmax;
todo!() use crate::common::parse_input;
#[derive(Copy, Clone, PartialOrd, PartialEq)]
struct Assignment(u32, u32);
impl Assignment {
fn one_contains(self, other: Self) -> bool {
let (first, second) = minmax(self, other);
if second.0 == first.0 {
first.1 <= second.1
} else {
second.0 <= first.1 && second.1 <= first.1
}
} }
pub fn part2(_input: &[u8]) -> Result<String> { fn one_overlaps(self, other: Self) -> bool {
todo!() let (first, second) = minmax(self, other);
if second.0 == first.0 {
first.1 <= second.1
} else {
second.0 <= first.1
}
}
}
fn parse_assignments(input: &[u8]) -> IResult<&[u8], Vec<(Assignment, Assignment)>> {
use nom::character::complete::u32;
fn parse_single(input: &[u8]) -> IResult<&[u8], Assignment> {
map(separated_pair(u32, tag("-"), u32), |(start, end)| {
Assignment(start, end)
})(input)
}
let parse_line = separated_pair(parse_single, tag(","), parse_single);
many0(terminated(parse_line, newline))(input)
}
fn parts_common(input: &[u8], filter: impl Fn(Assignment, Assignment) -> bool) -> Result<String> {
let assigments = parse_input(input, parse_assignments)?;
let overlapping = assigments
.into_iter()
.filter(|&(a, b)| filter(a, b))
.count();
Ok(overlapping.to_string())
}
pub fn part1(input: &[u8]) -> Result<String> {
parts_common(input, Assignment::one_contains)
}
pub fn part2(input: &[u8]) -> Result<String> {
parts_common(input, Assignment::one_overlaps)
}
#[cfg(test)]
mod tests {
use super::*;
const SAMPLE: &[u8] = include_bytes!("samples/04.txt");
#[test]
fn sample_part1() {
assert_eq!(part1(SAMPLE).unwrap(), "2")
}
#[test]
fn sample_part2() {
assert_eq!(part2(SAMPLE).unwrap(), "4")
}
} }

View File

@@ -1,9 +1,166 @@
use std::cmp::Ordering;
use anyhow::Result; use anyhow::Result;
use nom::branch::alt;
use nom::bytes::complete::tag;
use nom::bytes::complete::take;
use nom::bytes::complete::take_until;
use nom::character::complete::newline;
use nom::combinator::map;
use nom::combinator::opt;
use nom::multi::fold_many1;
use nom::multi::many1;
use nom::sequence::delimited;
use nom::sequence::preceded;
use nom::sequence::terminated;
use nom::sequence::tuple;
use nom::IResult;
pub fn part1(_input: &[u8]) -> Result<String> { use crate::common::enumerate;
todo!() use crate::common::parse_input;
type Move = (usize, usize, usize);
type OwnedStacks = Vec<Vec<u8>>;
fn parse_row<'a>(input: &'a [u8], stacks: &mut OwnedStacks) -> IResult<&'a [u8], ()> {
// Forgive me for this crime
fold_many1(
enumerate(terminated(
alt((
// Parse a delimited value into a Some(content)
map(delimited(tag("["), take(1usize), tag("]")), |v: &[u8]| {
Some(v[0])
}),
// Or an empty stack into a None
map(tag(" "), |_| None),
)),
opt(tag(" ")),
)),
|| (),
move |_, (index, c)| {
if let Some(b) = c {
if stacks.len() <= index {
stacks.resize_with(index + 1, Vec::new);
} }
pub fn part2(_input: &[u8]) -> Result<String> { stacks[index].push(b)
todo!() }
},
)(input)
}
fn parse_stacks(input: &[u8]) -> IResult<&[u8], OwnedStacks> {
let mut stacks = Vec::new();
let (input, _) = terminated(
fold_many1(
terminated(|input| parse_row(input, &mut stacks), newline),
|| (),
|_, _| (),
),
// Skip the line with the numbers
take_until("\n\n"),
)(input)?;
// Reverse the stacks since we parsed them top-down
for stack in &mut stacks {
stack.reverse();
}
Ok((input, stacks))
}
fn parse_task(input: &[u8]) -> IResult<&[u8], (OwnedStacks, Vec<Move>)> {
fn parse_usize(input: &[u8]) -> IResult<&[u8], usize> {
map(nom::character::complete::u32, |v| v as usize)(input)
}
let (input, stacks) = parse_stacks(input)?;
// Consume the double newline
let (input, _) = tag("\n\n")(input)?;
let (input, moves) = many1(terminated(
tuple((
preceded(tag("move "), parse_usize),
preceded(tag(" from "), parse_usize),
preceded(tag(" to "), parse_usize),
)),
newline,
))(input)?;
Ok((input, (stacks, moves)))
}
/// Some magic to get two mutable references into the same slice
fn get_both(stacks: &mut [Vec<u8>], from: usize, to: usize) -> (&mut Vec<u8>, &mut Vec<u8>) {
match from.cmp(&to) {
Ordering::Greater => {
let (begin, end) = stacks.split_at_mut(from);
(&mut end[0], &mut begin[to])
}
Ordering::Less => {
let (begin, end) = stacks.split_at_mut(to);
(&mut begin[from], &mut end[0])
}
Ordering::Equal => panic!("Tried to stack from and to {from}"),
}
}
fn compute_answer(stacks: &mut [Vec<u8>]) -> Result<String> {
let mut result = String::with_capacity(stacks.len());
for stack in stacks {
result.push(
*stack
.last()
.ok_or_else(|| anyhow::anyhow!("Encountered empty stack"))? as char,
);
}
Ok(result)
}
pub fn part1(input: &[u8]) -> Result<String> {
let (mut stacks, moves) = parse_input(input, parse_task)?;
for (count, from, to) in moves {
let (from, to) = get_both(&mut stacks, from - 1, to - 1);
let drain_start = from.len() - count;
to.extend(from.drain(drain_start..).rev());
}
compute_answer(&mut stacks)
}
pub fn part2(input: &[u8]) -> Result<String> {
let (mut stacks, moves) = parse_input(input, parse_task)?;
for (count, from, to) in moves {
let (from, to) = get_both(&mut stacks, from - 1, to - 1);
let drain_start = from.len() - count;
to.extend(from.drain(drain_start..));
}
compute_answer(&mut stacks)
}
#[cfg(test)]
mod tests {
use super::*;
const SAMPLE: &[u8] = include_bytes!("samples/05.txt");
#[test]
fn sample_part1() {
assert_eq!(part1(SAMPLE).unwrap(), "CMZ");
}
#[test]
fn sample_part2() {
assert_eq!(part2(SAMPLE).unwrap(), "MCD");
}
} }

View File

@@ -1,9 +1,68 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { fn find_first(input: &[u8], unique: usize) -> Result<usize> {
todo!() let mut seen = [false; 256];
let mut tail_it = input.iter();
let mut first = 0;
// Loop invariant: input[first..last] contains only unique characters
for (last, &c) in input.iter().enumerate() {
if seen[c as usize] {
first += (&mut tail_it)
.take_while(|&&b| b != c)
.map(|&b| seen[b as usize] = false)
.count()
+ 1; // +1 because take_while doesn't return the first element that didn't satisfy the condition, while we do need to count it
} else {
// New unique character found: input[first..=last] contains unique characters
if last - first + 1 == unique {
return Ok(last + 1);
} }
pub fn part2(_input: &[u8]) -> Result<String> { seen[c as usize] = true;
todo!() }
}
anyhow::bail!("Did not find unique sequence of length {unique}");
}
pub fn part1(input: &[u8]) -> Result<String> {
Ok(find_first(input, 4)?.to_string())
}
pub fn part2(input: &[u8]) -> Result<String> {
Ok(find_first(input, 14)?.to_string())
}
#[cfg(test)]
mod tests {
use super::*;
const SAMPLES: &[&[u8]] = &[
b"mjqjpqmgbljsphdztnvjfqwrcgsmlb",
b"bvwbjplbgvbhsrlpgdmjqwftvncz",
b"nppdvjthqldpwncqszvftbrmjlhg",
b"nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg",
b"zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw",
];
#[test]
fn sample_part1() {
const CORRECT: &[usize] = &[7, 5, 6, 10, 11];
for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
assert_eq!(find_first(sample, 4).unwrap(), correct);
}
}
#[test]
fn sample_part2() {
const CORRECT: &[usize] = &[19, 23, 23, 29, 26];
for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
assert_eq!(find_first(sample, 14).unwrap(), correct);
}
}
} }

View File

@@ -1,9 +1,124 @@
use anyhow::Context;
use anyhow::Result; use anyhow::Result;
use nom::branch::alt;
use nom::bytes::complete::tag;
use nom::bytes::complete::take_until;
use nom::character::complete::newline;
use nom::combinator::map;
use nom::combinator::opt;
use nom::multi::fold_many0;
use nom::sequence::delimited;
use nom::sequence::preceded;
use nom::sequence::terminated;
use nom::sequence::tuple;
use nom::IResult;
pub fn part1(_input: &[u8]) -> Result<String> { use crate::common::parse_input;
todo!()
fn parse_dir<'a>(
input: &'a [u8],
dirs: &mut Vec<u32>,
dir_stack: &mut Vec<&'a [u8]>,
) -> IResult<&'a [u8], u32> {
use nom::character::complete::u32;
enum Entry<'a> {
File(u32),
Dir(&'a [u8]),
}
let initial_len = dir_stack.len();
let (mut input, mut size) = preceded(
tag("$ ls\n"),
fold_many0(
// Map many newline-terminated entries
terminated(
// of either
alt((
// A size followed by a name
map(terminated(u32, take_until("\n")), Entry::File),
// Or the word "dir" followed by a name
map(preceded(tag("dir "), take_until("\n")), Entry::Dir),
)),
newline,
),
|| 0u32,
|files_sum, entry| match entry {
Entry::File(size) => files_sum + size,
Entry::Dir(name) => {
dir_stack.push(name);
files_sum
}
},
),
)(input)?;
for i in initial_len..dir_stack.len() {
let (new_input, content_size) = delimited(
tuple((tag("$ cd "), tag(dir_stack[i]), newline)),
|input| parse_dir(input, dirs, dir_stack),
// Optional cd'ing out because the last directory is never exited.
opt(tag("$ cd ..\n")),
)(input)?;
input = new_input;
size += content_size;
} }
pub fn part2(_input: &[u8]) -> Result<String> { dirs.push(size);
todo!() dir_stack.truncate(initial_len);
Ok((input, size))
}
fn parse_program(input: &[u8]) -> IResult<&[u8], (u32, Vec<u32>)> {
let mut dirs = Vec::new();
let mut dirstack = Vec::new();
let (input, size) = preceded(tag("$ cd /\n"), |input| {
parse_dir(input, &mut dirs, &mut dirstack)
})(input)?;
Ok((input, (size, dirs)))
}
pub fn part1(input: &[u8]) -> Result<String> {
let (_, sizes) = parse_input(input, parse_program)?;
let searched_size: u32 = sizes.into_iter().filter(|&size| size <= 100000).sum();
Ok(searched_size.to_string())
}
pub fn part2(input: &[u8]) -> Result<String> {
const TARGET: u32 = 30000000;
const TOTAL: u32 = 70000000;
let (used, sizes) = parse_input(input, parse_program)?;
let required = TARGET - (TOTAL - used);
let min = sizes
.into_iter()
.filter(|&size| size >= required)
.min()
.context("Did not find dir large enough to delete")?;
Ok(min.to_string())
}
#[cfg(test)]
mod tests {
use super::*;
const SAMPLE: &[u8] = include_bytes!("samples/07.txt");
#[test]
fn sample_part1() {
assert_eq!(part1(SAMPLE).unwrap(), "95437");
}
#[test]
fn sample_part2() {
assert_eq!(part2(SAMPLE).unwrap(), "24933642");
}
} }

View File

@@ -1,9 +1,163 @@
use std::cmp::Ordering;
use anyhow::Context;
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { #[inline]
todo!() fn stripe<'a>(
values: impl IntoIterator<Item = &'a u8>,
visible: impl IntoIterator<Item = &'a mut bool>,
) {
let mut max = 0;
for (&val, visible) in values.into_iter().zip(visible) {
if val > max {
max = val;
*visible = true;
if val == b'9' {
return;
}
}
}
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part1(input: &[u8]) -> Result<String> {
todo!() let width = input
.iter()
.position(|&b| b == b'\n')
.context("Single row field")?;
let height = input.len() / (width + 1); // Include newlines
let mut visible = vec![false; width * height];
// Horizontal striping
for (y, row) in input.chunks_exact(width + 1).enumerate() {
// First, left to right
stripe(&row[..width], &mut visible[(y * width)..]);
// Then right to left
stripe(
row[..width].iter().rev(),
visible[(y * width)..(y * width + width)].iter_mut().rev(),
);
}
// Vertical striping
for x in 0..width {
// Top to bottom
stripe(
input[x..].iter().step_by(width + 1),
visible[x..].iter_mut().step_by(width),
);
// Bottom to top
stripe(
input[x..].iter().step_by(width + 1).rev(),
visible[x..].iter_mut().step_by(width).rev(),
)
}
Ok(visible.into_iter().filter(|&b| b).count().to_string())
}
#[inline]
fn scenery<'a>(
values: impl IntoIterator<Item = &'a u8>,
visible: impl IntoIterator<Item = &'a mut usize>,
tree_stack: &mut Vec<(usize, u8)>,
) {
tree_stack.clear();
for (i, (&val, score)) in values.into_iter().zip(visible).enumerate() {
scenery_helper(i, tree_stack, val, score);
}
}
fn scenery_helper(i: usize, tree_stack: &mut Vec<(usize, u8)>, val: u8, score: &mut usize) {
if i > 0 {
let mut first = 0;
while let Some((pos, other)) = tree_stack.pop() {
match other.cmp(&val) {
Ordering::Less => (),
Ordering::Equal => {
first = pos;
break;
}
Ordering::Greater => {
tree_stack.push((pos, other));
first = pos;
break;
}
}
}
tree_stack.push((i, val));
*score *= i - first;
} else {
*score = 0;
}
}
pub fn part2(input: &[u8]) -> Result<String> {
let width = input
.iter()
.position(|&b| b == b'\n')
.context("Single row field")?;
let height = input.len() / (width + 1); // Include newlines
let mut score = vec![1; width * height];
let mut tree_stack = Vec::with_capacity(10);
// Horizontal striping
for (y, row) in input.chunks_exact(width + 1).enumerate() {
// First, left to right
scenery(&row[..width], &mut score[(y * width)..], &mut tree_stack);
// Then right to left
scenery(
row[..width].iter().rev(),
score[(y * width)..(y * width + width)].iter_mut().rev(),
&mut tree_stack,
);
}
// Vertical striping
for x in 0..width {
// Top to bottom
scenery(
input[x..].iter().step_by(width + 1),
score[x..].iter_mut().step_by(width),
&mut tree_stack,
);
// Bottom to top
scenery(
input[x..].iter().step_by(width + 1).rev(),
score[x..].iter_mut().step_by(width).rev(),
&mut tree_stack,
)
}
Ok(score.into_iter().max().context("empty field")?.to_string())
}
#[cfg(test)]
mod tests {
use super::*;
const SAMPLE: &[u8] = include_bytes!("samples/08.txt");
#[test]
fn sample_part1() {
assert_eq!(part1(SAMPLE).unwrap(), "21");
}
#[test]
fn sample_part2() {
assert_eq!(part2(SAMPLE).unwrap(), "8");
}
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,9 +1,9 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }
pub fn part2(_input: &[u8]) -> Result<String> { pub fn part2(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

View File

@@ -1,5 +1,5 @@
use anyhow::Result; use anyhow::Result;
pub fn part1(_input: &[u8]) -> Result<String> { pub fn part1(_input: &[u8]) -> Result<String> {
todo!() anyhow::bail!("not implemented")
} }

6
2022/src/samples/04.txt Normal file
View File

@@ -0,0 +1,6 @@
2-4,6-8
2-3,4-5
5-7,7-9
2-8,3-7
6-6,4-6
2-6,4-8

9
2022/src/samples/05.txt Normal file
View File

@@ -0,0 +1,9 @@
[D]
[N] [C]
[Z] [M] [P]
1 2 3
move 1 from 2 to 1
move 3 from 1 to 3
move 2 from 2 to 1
move 1 from 1 to 2

23
2022/src/samples/07.txt Normal file
View File

@@ -0,0 +1,23 @@
$ cd /
$ ls
dir a
14848514 b.txt
8504156 c.dat
dir d
$ cd a
$ ls
dir e
29116 f
2557 g
62596 h.lst
$ cd e
$ ls
584 i
$ cd ..
$ cd ..
$ cd d
$ ls
4060174 j
8033020 d.log
5626152 d.ext
7214296 k

5
2022/src/samples/08.txt Normal file
View File

@@ -0,0 +1,5 @@
30373
25512
65332
33549
35390