Slightly better ICACHE hits

230 byte overhead is worth it to avoid conversions and potential
indexing errors

.github/workflows/2022.yml

@@ -1,7 +1,7 @@
 on:
   - push
 
-name: Advent of Code 2021
+name: Advent of Code 2022
 
 jobs:
   ci:
@@ -20,7 +20,7 @@ jobs:
     continue-on-error: ${{ matrix.experimental }}
 
     steps:
-      - uses: actions/checkout@v2
+      - uses: actions/checkout@v3
 
       - name: Install toolchain
         uses: actions-rs/toolchain@v1
@@ -30,17 +30,23 @@ jobs:
           override: true
           components: rustfmt, clippy
 
+      - name: Set up caching
+        uses: Swatinem/rust-cache@v2
+        with:
+          workspaces: >
+            2022 -> target
+
       - name: Build binaries
-        working-directory: 2021
+        working-directory: 2022
         run: >
           cargo build --all-targets
 
       - name: Run tests
-        working-directory: 2021
+        working-directory: 2022
         run: >
           cargo test
 
       - name: Run clippy
-        working-directory: 2021
+        working-directory: 2022
         run: >
           cargo clippy -- --deny warnings

2016/day-04/Cargo.toml

@@ -4,4 +4,4 @@ version = "0.1.0"
 authors = ["Bert Peters <bert.ljpeters@gmail.com>"]
 
 [dependencies]
-regex = "0.1"
+regex = "1"

2016/day-04/src/main.rs

@@ -73,10 +73,10 @@ fn main() {
         let door_label = line.unwrap();
         let caps = room_pattern.captures(&door_label).unwrap();
 
-        let name = caps.at(1).unwrap();
+        let name = caps.get(1).unwrap().as_str();
-        let checksum = caps.at(4).unwrap();
+        let checksum = caps.get(4).unwrap().as_str();
         if is_valid(name, checksum) {
-            let sector_id = caps.at(3).unwrap().parse().unwrap();
+            let sector_id = caps.get(3).unwrap().as_str().parse().unwrap();
             cur_sum += sector_id;
 
             let decoded: String = name.chars()

2016/day-09/Cargo.toml

@@ -4,5 +4,5 @@ version = "0.1.0"
 authors = ["Bert Peters <bert.ljpeters@gmail.com>"]
 
 [dependencies]
-regex = "^0.1"
+regex = "1"
-lazy_static = "^0.2"
+lazy_static = "1"

2016/day-10/Cargo.toml

@@ -4,4 +4,4 @@ version = "0.1.0"
 authors = ["Bert Peters <bert.ljpeters@gmail.com>"]
 
 [dependencies]
-regex="^0.1"
+regex="1"

2021/Cargo.toml

@@ -5,7 +5,7 @@ edition = "2021"
 
 
 [dependencies]
-clap = { version = "3.0.0-rc.0", features = ["derive"] }
+clap = { version = "3", features = ["derive"] }
 itertools = "0.10"
 nom = "7"
 

2021/README.md

@@ -20,3 +20,15 @@ OPTIONS:
     -i, --input <INPUT>    Read input from the given file instead of stdin
     -t, --time             Print time taken
 ```
+
+## That goal was achieved
+
+Runtime benchmarked with [Criterion], reading input directly from memory to avoid disk IO
+inconsistencies.
+
+![Cumulative time](./cumulative-time.svg)
+
+![Time by day](./individual-time.svg)
+
+
+[Criterion]: https://github.com/bheisler/criterion.rs

2021/create_timing_plots.py

@@ -0,0 +1,97 @@
+#!/usr/bin/env python3
+import json
+from pathlib import Path
+from typing import Dict
+
+import numpy as np
+import matplotlib.pyplot as plt
+
+
+def read_timings() -> Dict[int, Dict]:
+    timings = {}
+
+    for day in Path('target/criterion/part1').iterdir():
+        with open(day / 'new' / 'estimates.json', mode='rb') as f:
+            timings[int(day.parts[-1])] = {
+                1: json.load(f)
+            }
+
+    for day in Path('target/criterion/part2').iterdir():
+        with open(day / 'new' / 'estimates.json', mode='rb') as f:
+            timings[int(day.parts[-1])][2] = json.load(f)
+
+    return timings
+
+
+def plot_cumulative_time(timings: Dict[int, Dict]):
+    plt.clf()
+
+    times = [0]
+
+    for day in range(min(timings.keys()), max(timings.keys()) + 1):
+        times.append(timings[day][1]['mean']['point_estimate'])
+        if day < 25:
+            times.append(timings[day][2]['mean']['point_estimate'])
+        else:
+            times.append(0)
+
+    cumulative = np.cumsum(times)
+    # Convert from nanoseconds to seconds
+    cumulative /= 1e9
+
+    x = np.arange(0.0, 25.5, 0.5)
+
+    plt.plot(x, cumulative, label="Cumulative time", drawstyle='steps-post')
+    plt.plot([0, 25], [0, 0.5], label="Target time")
+    plt.ylabel('Cumulative time (s)')
+    plt.xlabel('Days completed')
+
+    plt.legend()
+    plt.tight_layout()
+
+    plt.xlim(0, 25)
+    plt.ylim(0, 0.5)
+
+    plt.savefig('cumulative-time.svg')
+
+
+def plot_individual_times(timings: Dict[int, Dict]):
+    plt.clf()
+
+    def plot(parts, **kwargs):
+        x = np.arange(1, len(parts) + 1)
+
+        values = np.array(list(part['mean']['point_estimate'] for part in parts))
+        upper = np.array(list(part['mean']['confidence_interval']['upper_bound'] for part in parts))
+        lower = np.array(list(part['mean']['confidence_interval']['lower_bound'] for part in parts))
+
+        # Convert from ns to s
+        yerr = np.array([upper - values, lower - values]) / 1e9
+        values = values / 1e9
+
+        plt.bar(x, values, yerr=yerr, align='edge', log=True, **kwargs)
+        pass
+
+    plot(list(timings[day][1] for day in range(1, 26)), label="Part 1", width=-0.4)
+    plot(list(timings[day][2] for day in range(1, 25)), label="Part 2", width=0.4)
+
+    plt.ylabel('Runtime (s)')
+    plt.xlabel('Day')
+
+    plt.xlim(0, 26)
+    plt.xticks(np.arange(1, 26))
+
+    plt.legend()
+    plt.tight_layout()
+
+    plt.savefig('individual-time.svg')
+
+
+def main():
+    timings = read_timings()
+    plot_cumulative_time(timings)
+    plot_individual_times(timings)
+
+
+if __name__ == '__main__':
+    main()

2021/src/common.rs

@@ -90,7 +90,65 @@ where
     let mut buffer = Vec::new();
     input.read_to_end(&mut buffer).unwrap();
 
-    let (_, output) = parser(&buffer).finish().unwrap();
+    match parser(&buffer).finish() {
-
+        Ok((_, output)) => output,
-    output
+        Err(err) => {
+            panic!(
+                "Failed to parse input with error {:?} at \"{}\"",
+                err.code,
+                String::from_utf8_lossy(err.input)
+            );
+        }
+    }
+}
+
+#[derive(Default)]
+pub struct BitSet {
+    buffer: Vec<u32>,
+}
+
+impl BitSet {
+    pub fn new() -> Self {
+        Self::default()
+    }
+
+    pub fn with_capacity(capacity: usize) -> Self {
+        let buffer = vec![0; capacity / 32];
+
+        Self { buffer }
+    }
+
+    fn convert_value(value: usize) -> (usize, u32) {
+        let chunk = value / 32;
+        let bit = 1 << (31 - (value % 32));
+
+        (chunk, bit)
+    }
+
+    pub fn insert(&mut self, value: usize) -> bool {
+        let (chunk, bit) = Self::convert_value(value);
+
+        if self.buffer.len() <= chunk + 1 {
+            self.buffer.resize(chunk + 1, 0);
+        }
+
+        let not_present = self.buffer[chunk] & bit;
+
+        self.buffer[chunk] |= bit;
+
+        not_present == 0
+    }
+
+    pub fn len(&self) -> usize {
+        self.buffer.iter().map(|c| c.count_ones() as usize).sum()
+    }
+
+    pub fn contains(&self, value: usize) -> bool {
+        let (chunk, bit) = Self::convert_value(value);
+
+        self.buffer
+            .get(chunk)
+            .map(|&c| c & bit != 0)
+            .unwrap_or(false)
+    }
 }

2021/src/day05.rs

@@ -1,69 +1,95 @@
-use std::collections::HashMap;
 use std::io::Read;
 use std::iter::repeat;
 
 use nom::bytes::complete::tag;
-use nom::sequence::tuple;
+use nom::character::complete::newline;
-use nom::Finish;
+use nom::combinator::map;
+use nom::multi::separated_list1;
+use nom::sequence::separated_pair;
 use nom::IResult;
 
 use crate::common::ordered;
-use crate::common::LineIter;
+use crate::common::read_input;
+use crate::common::BitSet;
 
 type Coord = (u16, u16);
 
-fn coordinates(input: &str) -> IResult<&str, Coord> {
+fn coordinates(input: &[u8]) -> IResult<&[u8], Coord> {
-    use nom::character::complete;
+    use nom::character::complete::char;
+    use nom::character::complete::u16;
 
-    let (input, (x, _, y)) = tuple((complete::u16, complete::char(','), complete::u16))(input)?;
+    separated_pair(u16, char(','), u16)(input)
-
-    Ok((input, (x, y)))
 }
 
-fn line_definition(input: &str) -> IResult<&str, (Coord, Coord)> {
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<(Coord, Coord)>> {
-    let (input, (begin, _, end)) = tuple((coordinates, tag(" -> "), coordinates))(input)?;
+    let read_line = map(
+        separated_pair(coordinates, tag(" -> "), coordinates),
+        |(begin, end)| ordered(begin, end),
+    );
 
-    // Sorting the coordinates saves trouble later
+    separated_list1(newline, read_line)(input)
-    Ok((input, ordered(begin, end)))
 }
 
 fn stripe(
-    map: &mut HashMap<Coord, u16>,
+    once: &mut BitSet,
+    twice: &mut BitSet,
+    width: usize,
     xs: impl Iterator<Item = u16>,
     ys: impl Iterator<Item = u16>,
 ) {
     for (x, y) in xs.zip(ys) {
-        *map.entry((x, y)).or_default() += 1;
+        let index = x as usize + y as usize * width;
+        if !once.insert(index) {
+            twice.insert(index);
+        }
     }
 }
 
 fn part_common(input: &mut dyn Read, diagonals: bool) -> String {
-    let mut reader = LineIter::new(input);
+    let lines = read_input(input, parse_input);
-    let mut map = HashMap::new();
 
-    while let Some(line) = reader.next() {
+    let width = lines
-        let (begin, end) = line_definition(line).finish().unwrap().1;
+        .iter()
+        .map(|&(_, (x, _))| x as usize + 1)
+        .max()
+        .unwrap();
 
+    let mut once_map = BitSet::new();
+    let mut twice_map = BitSet::new();
+
+    for (begin, end) in lines {
         if begin.0 == end.0 {
             let y_range = begin.1..=end.1;
-            stripe(&mut map, repeat(begin.0), y_range);
+            stripe(
+                &mut once_map,
+                &mut twice_map,
+                width,
+                repeat(begin.0),
+                y_range,
+            );
         } else if begin.1 == end.1 {
             let x_range = begin.0..=end.0;
-            stripe(&mut map, x_range, repeat(begin.1));
+            stripe(
+                &mut once_map,
+                &mut twice_map,
+                width,
+                x_range,
+                repeat(begin.1),
+            );
         } else if diagonals {
             let x_range = begin.0..=end.0;
             let y_range = (begin.1.min(end.1))..=(begin.1.max(end.1));
 
             if begin.1 > end.1 {
                 // For a downward slope we need to reverse Y
-                stripe(&mut map, x_range, y_range.rev());
+                stripe(&mut once_map, &mut twice_map, width, x_range, y_range.rev());
             } else {
-                stripe(&mut map, x_range, y_range);
+                stripe(&mut once_map, &mut twice_map, width, x_range, y_range);
             }
         }
     }
 
-    map.values().filter(|&&v| v > 1).count().to_string()
+    twice_map.len().to_string()
 }
 
 pub fn part1(input: &mut dyn Read) -> String {
@@ -82,11 +108,6 @@ mod tests {
 
     const SAMPLE: &[u8] = include_bytes!("samples/05.txt");
 
-    #[test]
-    fn test_parser() {
-        assert_eq!(line_definition("6,4 -> 2,0"), Ok(("", ((2, 0), (6, 4)))));
-    }
-
     #[test]
     fn sample_part1() {
         test_implementation(part1, SAMPLE, 5)

2021/src/day13.rs

@@ -48,7 +48,7 @@ fn parse_fold(input: &[u8]) -> IResult<&[u8], Fold> {
     )(input)
 }
 
-fn apply_fold(dots: &mut Vec<Coords>, fold: Fold) {
+fn apply_fold(dots: &mut [Coords], fold: Fold) {
     match fold {
         Fold::X(coord) => dots.iter_mut().for_each(|(x, _)| {
             if *x >= coord {

2021/src/day16.rs

@@ -182,7 +182,7 @@ mod tests {
     fn sample_part1() {
         let answers = [16, 12, 23, 31];
 
-        for (&sample, answer) in SAMPLE.into_iter().zip(answers) {
+        for (&sample, answer) in SAMPLE.iter().zip(answers) {
             test_implementation(part1, sample, answer);
         }
     }

2021/src/day19.rs

@@ -1,6 +1,8 @@
+use std::collections::HashMap;
 use std::collections::HashSet;
 use std::io::Read;
 use std::ops::Add;
+use std::ops::Deref;
 use std::ops::Sub;
 
 use nom::bytes::complete::tag;
@@ -23,6 +25,10 @@ impl Point3 {
     pub fn manhattan(&self) -> i32 {
         self.0.into_iter().map(i32::abs).sum()
     }
+
+    pub fn euler_square(&self) -> i32 {
+        self.0.into_iter().map(|c| c * c).sum()
+    }
 }
 
 impl Sub for Point3 {
@@ -49,6 +55,44 @@ impl Add for Point3 {
     }
 }
 
+struct Scanner {
+    visible: Vec<Point3>,
+    distances: HashMap<i32, (Point3, Point3)>,
+}
+
+impl Scanner {
+    pub fn new(visible: Vec<Point3>) -> Self {
+        let distances = visible
+            .iter()
+            .enumerate()
+            .flat_map(|(skip, &a)| {
+                visible[(skip + 1)..]
+                    .iter()
+                    .map(move |&b| ((a - b).euler_square(), (a, b)))
+            })
+            .collect();
+
+        Self { visible, distances }
+    }
+
+    pub fn can_overlap(&self, other: &Self) -> bool {
+        other
+            .distances
+            .keys()
+            .filter(|&k| self.distances.contains_key(k))
+            .count()
+            >= 11
+    }
+}
+
+impl Deref for Scanner {
+    type Target = [Point3];
+
+    fn deref(&self) -> &Self::Target {
+        &self.visible
+    }
+}
+
 struct Rotations<'a> {
     points: &'a [Point3],
     axes: [usize; 3],
@@ -119,32 +163,56 @@ fn parse_point(input: &[u8]) -> IResult<&[u8], Point3> {
     )(input)
 }
 
-fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<Vec<Point3>>> {
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<Scanner>> {
     use nom::character::complete::i32;
     let parse_header = delimited(tag("--- scanner "), i32, tag(" ---\n"));
 
-    let parse_scanner = preceded(parse_header, many1(terminated(parse_point, newline)));
+    let parse_scanner = map(
+        preceded(parse_header, many1(terminated(parse_point, newline))),
+        Scanner::new,
+    );
     separated_list1(newline, parse_scanner)(input)
 }
 
-fn try_overlap(
+fn find_pivot(group: &Scanner, related: &Scanner) -> Option<Point3> {
-    correct: &[(Point3, HashSet<Point3>)],
+    let mut counter = HashMap::new();
-    candidate: &[Point3],
+
-) -> Option<(Point3, Vec<Point3>)> {
+    for (distance, &(a, b)) in &group.distances {
-    let mut relative = HashSet::new();
+        if related.distances.contains_key(distance) {
+            *counter.entry(a).or_insert(0) += 1;
+            *counter.entry(b).or_insert(0) += 1;
+        }
+    }
+
+    counter
+        .into_iter()
+        .max_by_key(|(_, count)| *count)
+        .map(|t| t.0)
+}
+
+fn try_overlap(matched: &Scanner, candidate: &Scanner) -> Option<(Point3, Scanner)> {
+    if !matched.can_overlap(candidate) {
+        return None;
+    }
+
+    let matched_pivot = find_pivot(matched, candidate)?;
+
+    let correct: HashSet<_> = matched.iter().map(|&base| base - matched_pivot).collect();
+
     for rot in Rotations::new(candidate) {
         for &start in &rot {
-            relative.clear();
+            let translated_iter = rot.iter().map(|&other| other - start);
 
-            relative.extend(rot.iter().map(|&other| other - start));
+            if translated_iter
-
+                .clone()
-            if let Some((base, _)) = correct.iter().find(|(_, correct_relative)| {
+                .filter(|p| correct.contains(p))
-                correct_relative.intersection(&relative).count() >= 12
+                .count()
-            }) {
+                >= 12
+            {
                 // Found a solution, build the correct output
-                let translated = relative.drain().map(|point| point + *base).collect();
+                let translated = translated_iter.map(|point| point + matched_pivot).collect();
 
-                return Some((start - *base, translated));
+                return Some((start - matched_pivot, Scanner::new(translated)));
             }
         }
     }
@@ -157,33 +225,30 @@ fn parts_common(input: &mut dyn Read) -> (HashSet<Point3>, Vec<Point3>) {
 
     let mut points: HashSet<_> = scanners[0].iter().copied().collect();
 
-    let mut todo = vec![std::mem::take(&mut scanners[0])];
+    let mut todo = vec![scanners.remove(0)];
     let mut scanners_found = vec![Point3::default()];
 
     while let Some(matched) = todo.pop() {
-        if scanners.iter().all(Vec::is_empty) {
+        if scanners.is_empty() {
             break;
         }
 
-        let relative: Vec<(Point3, HashSet<Point3>)> = matched
+        let mut i = 0;
-            .iter()
-            .map(|&base| (base, matched.iter().map(|&other| (other - base)).collect()))
-            .collect();
 
-        for candidate in &mut scanners {
+        while i < scanners.len() {
-            if candidate.is_empty() {
+            if let Some((scanner, result)) = try_overlap(&matched, &scanners[i]) {
-                continue;
+                scanners.remove(i);
-            }
-
-            if let Some((scanner, result)) = try_overlap(&relative, candidate) {
                 scanners_found.push(scanner);
                 points.extend(result.iter().copied());
                 todo.push(result);
-                candidate.clear();
+            } else {
+                i += 1;
             }
         }
     }
 
+    assert!(scanners.is_empty());
+
     (points, scanners_found)
 }
 

2021/src/day20.rs

@@ -1,10 +1,124 @@
-use std::collections::HashSet;
+use std::fmt::Display;
 use std::io::Read;
-use std::mem::swap;
+use std::ops::Index;
+
+use crate::common::BitSet;
 
 type Translation = [bool; 512];
-type Point = (i32, i32);
+
-type Field = HashSet<Point>;
+struct Field {
+    width: usize,
+    height: usize,
+    infinity: bool,
+    finite: BitSet,
+}
+
+impl Field {
+    pub fn from_input<'a>(input: impl Iterator<Item = &'a [u8]>) -> Self {
+        let mut input = input.peekable();
+
+        let width = input.peek().unwrap().len();
+
+        let mut finite = BitSet::new();
+
+        let len = input
+            .flatten()
+            .enumerate()
+            .map(|(index, &c)| {
+                if c == b'#' {
+                    finite.insert(index);
+                }
+            })
+            .count();
+
+        debug_assert_eq!(len % width, 0);
+        let height = len / width;
+
+        Self {
+            width,
+            height,
+            finite,
+            infinity: false,
+        }
+    }
+
+    pub fn advance(&mut self, translation: &[bool; 512]) {
+        const INDEX_MASK: usize = (1 << 9) - 1;
+
+        let new_width = self.width + 2;
+        let new_height = self.height + 2;
+
+        let mut new_finite = BitSet::with_capacity(new_width * new_height);
+
+        for y in 0..new_height {
+            let mut mask = if self.infinity { INDEX_MASK } else { 0 };
+
+            for x in 0..new_width {
+                const COLUMN_MASK: usize = 0b001001001;
+                let mut submask = if self.infinity { COLUMN_MASK } else { 0 };
+
+                for y in y.saturating_sub(2)..=y {
+                    submask = (submask << 3) | (self[(x, y)] as usize);
+                }
+
+                mask <<= 1;
+                mask &= !COLUMN_MASK;
+                mask |= submask;
+                mask &= INDEX_MASK;
+
+                if translation[mask] {
+                    let index = x + y * new_width;
+                    new_finite.insert(index);
+                }
+            }
+        }
+
+        self.width += 2;
+        self.height += 2;
+        self.finite = new_finite;
+        self.infinity = translation[if self.infinity { INDEX_MASK } else { 0 }];
+    }
+
+    pub fn len(&self) -> usize {
+        assert!(!self.infinity);
+        self.finite.len()
+    }
+}
+
+impl Index<(usize, usize)> for Field {
+    type Output = bool;
+
+    #[inline]
+    fn index(&self, (x, y): (usize, usize)) -> &Self::Output {
+        if x >= self.width || y >= self.height {
+            return &self.infinity;
+        }
+
+        let index = x + y * self.width;
+
+        if self.finite.contains(index) {
+            &true
+        } else {
+            &false
+        }
+    }
+}
+
+impl Display for Field {
+    fn fmt(&self, f: &mut std::fmt::Formatter<'_>) -> std::fmt::Result {
+        for y in 0..self.height {
+            for x in 0..self.width {
+                if self[(x, y)] {
+                    write!(f, "#")?
+                } else {
+                    write!(f, ".")?
+                }
+            }
+            writeln!(f)?;
+        }
+        Ok(())
+    }
+}
 
 fn read_input(input: &mut dyn Read) -> (Translation, Field) {
     let mut buffer = Vec::new();
@@ -19,67 +133,16 @@ fn read_input(input: &mut dyn Read) -> (Translation, Field) {
         .zip(it.next().unwrap())
         .for_each(|(t, &c)| *t = c == b'#');
 
-    let mut field = Field::default();
+    let field = Field::from_input(it.skip(1));
-
-    for (y, line) in it.skip(1).enumerate() {
-        for (x, _) in line.iter().enumerate().filter(|(_, &c)| c == b'#') {
-            field.insert((x as i32, y as i32));
-        }
-    }
 
     (translation, field)
 }
 
-fn find_dimensions(field: &Field) -> ((i32, i32), (i32, i32)) {
-    field
-        .iter()
-        .fold(((0, 0), (0, 0)), |((xmin, xmax), (ymin, ymax)), &(x, y)| {
-            ((xmin.min(x), xmax.max(x)), (ymin.min(y), ymax.max(y)))
-        })
-}
-
-fn advance(translation: &Translation, field: &Field, new_field: &mut Field, infinity: &mut bool) {
-    const INDEX_MASK: usize = (1 << 9) - 1;
-    new_field.clear();
-
-    let ((xmin, xmax), (ymin, ymax)) = find_dimensions(field);
-
-    for x in (xmin - 1)..=(xmax + 1) {
-        let mut index = if *infinity { INDEX_MASK } else { 0 };
-
-        for y in (ymin - 1)..=(ymax + 1) {
-            for dx in -1..=1 {
-                index <<= 1;
-
-                let nx = x + dx;
-                let ny = y + 1;
-
-                if nx < xmin || nx > xmax || ny < ymin || ny > ymax {
-                    index |= *infinity as usize;
-                } else if field.contains(&(nx, ny)) {
-                    index |= 1;
-                }
-            }
-
-            index &= INDEX_MASK;
-
-            if translation[index] {
-                new_field.insert((x, y));
-            }
-        }
-    }
-
-    *infinity = translation[if *infinity { 511 } else { 0 }]
-}
-
 fn parts_common(input: &mut dyn Read, count: usize) -> String {
     let (translation, mut field) = read_input(input);
-    let mut new_field = Field::new();
-    let mut infinity = false;
 
     for _ in 0..count {
-        advance(&translation, &field, &mut new_field, &mut infinity);
+        field.advance(&translation);
-        swap(&mut field, &mut new_field);
     }
 
     field.len().to_string()

2021/src/day23.rs

@@ -1,9 +1,451 @@
+use std::cmp::Reverse;
+use std::collections::hash_map::Entry;
+use std::collections::BinaryHeap;
+use std::collections::HashMap;
+use std::fmt::Display;
 use std::io::Read;
+use std::mem::swap;
 
-pub fn part1(_input: &mut dyn Read) -> String {
+use crate::common::LineIter;
-    todo!()
+
+type Item<const S: usize> = (u32, State<S>);
+type Todo<const S: usize> = BinaryHeap<Reverse<Item<S>>>;
+type Visited<const S: usize> = HashMap<State<S>, u32>;
+
+#[derive(Debug, PartialEq, Eq, PartialOrd, Ord, Copy, Clone, Hash)]
+enum Pod {
+    A,
+    B,
+    C,
+    D,
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
+impl Pod {
-    todo!()
+    pub fn cost(self) -> u32 {
+        match self {
+            Pod::A => 1,
+            Pod::B => 10,
+            Pod::C => 100,
+            Pod::D => 1000,
+        }
+    }
+
+    pub fn dest(self) -> usize {
+        self as usize
+    }
+}
+
+impl TryFrom<usize> for Pod {
+    type Error = usize;
+
+    fn try_from(index: usize) -> Result<Self, Self::Error> {
+        match index {
+            0 => Ok(Pod::A),
+            1 => Ok(Pod::B),
+            2 => Ok(Pod::C),
+            3 => Ok(Pod::D),
+            _ => Err(index),
+        }
+    }
+}
+
+impl TryFrom<char> for Pod {
+    type Error = &'static str;
+
+    fn try_from(c: char) -> Result<Self, Self::Error> {
+        match c {
+            'A' => Ok(Pod::A),
+            'B' => Ok(Pod::B),
+            'C' => Ok(Pod::C),
+            'D' => Ok(Pod::D),
+            _ => Err("Invalid pod"),
+        }
+    }
+}
+
+#[derive(Debug, PartialEq, Eq, PartialOrd, Ord, Clone, Hash)]
+struct State<const S: usize> {
+    hallway: [Option<Pod>; 11],
+    rooms: [[Option<Pod>; S]; 4],
+}
+
+fn room_hallway_pos(room: usize) -> usize {
+    room * 2 + 2
+}
+
+fn abs_delta(a: usize, b: usize) -> usize {
+    if a < b {
+        b - a
+    } else {
+        a - b
+    }
+}
+
+impl<const S: usize> State<S> {
+    const VALID_HALLWAY_POS: [usize; 7] = [0, 1, 3, 5, 7, 9, 10];
+
+    pub fn is_done(&self) -> bool {
+        self == &State {
+            hallway: Default::default(),
+            rooms: [
+                [Some(Pod::A); S],
+                [Some(Pod::B); S],
+                [Some(Pod::C); S],
+                [Some(Pod::D); S],
+            ],
+        }
+    }
+
+    fn add_to_queue(self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        let entry = visited.entry(self.clone());
+
+        if matches!(&entry, Entry::Occupied(entry) if *entry.get() <= cost) {
+            // Already got a better one
+            return;
+        }
+
+        // nightly only :'(
+        // entry.insert(cost);
+        *entry.or_default() = cost;
+
+        todo.push(Reverse((cost + self.estimate(), self)))
+    }
+
+    fn estimate(&self) -> u32 {
+        // A* estimate. For every entry that is not already "at rest", the cost is the cost
+        // required to get it to the top of its intended room.
+
+        // Cost to enter the hole for all pods that still need to
+        let enter_estimate: u32 = self
+            .rooms
+            .iter()
+            .enumerate()
+            .map(|(index, room)| {
+                let pod = Pod::try_from(index).unwrap();
+
+                room.iter()
+                    .enumerate()
+                    .rev()
+                    .skip_while(|&(_, &entry)| entry == Some(pod))
+                    .map(|(index, _)| index as u32 + 1)
+                    .sum::<u32>()
+                    * pod.cost()
+            })
+            .sum();
+
+        // Cost for all of the hallway to move to above their intended rooms
+        let hallway_estimate: u32 = self
+            .hallway
+            .iter()
+            .enumerate()
+            .filter_map(|(pos, &pod)| {
+                let pod = pod?;
+
+                let destination_pos = room_hallway_pos(pod.dest());
+
+                Some(abs_delta(pos, destination_pos) as u32 * pod.cost())
+            })
+            .sum();
+
+        // Cost to move out of the room and above the correct rooms
+        let rooms_estimate: u32 = self
+            .rooms
+            .iter()
+            .enumerate()
+            .map(|(room_index, room)| {
+                let hallway_pos = room_hallway_pos(room_index);
+
+                room.iter()
+                    .enumerate()
+                    .rev()
+                    .skip_while(|&(_, &entry)| {
+                        entry.map(|pod| pod.dest() == room_index).unwrap_or(false)
+                    })
+                    .filter_map(|(room_pos, &pod)| {
+                        let pod = pod?;
+
+                        let destination_pos = room_hallway_pos(pod.dest());
+
+                        let steps = 1 + room_pos + abs_delta(hallway_pos, destination_pos).max(2);
+
+                        Some(steps as u32 * pod.cost())
+                    })
+                    .sum::<u32>()
+            })
+            .sum();
+
+        enter_estimate + hallway_estimate + rooms_estimate
+    }
+
+    pub fn generate_next(&self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        self.room_to_hallway(cost, todo, visited);
+        self.hallway_to_room(cost, todo, visited);
+    }
+
+    fn room_to_hallway(&self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        for (index, room) in self.rooms.iter().enumerate() {
+            // Check if we even want to move anything out of this room
+            if room
+                .iter()
+                .all(|entry| entry.map(|pod| pod.dest() == index).unwrap_or(true))
+            {
+                continue;
+            }
+
+            let (pos, pod) = room
+                .iter()
+                .enumerate()
+                .find_map(|(pos, entry)| entry.map(|pod| (pos, pod)))
+                .unwrap(); // Safe unwrap, we know it exists from above.
+
+            let base_cost = 1 + pos;
+            let hallway_pos = room_hallway_pos(index);
+
+            let mut queue_new = |new_pos, new_cost| {
+                let mut new_state = self.clone();
+                swap(
+                    &mut new_state.hallway[new_pos],
+                    &mut new_state.rooms[index][pos],
+                );
+
+                new_state.add_to_queue(new_cost + cost, todo, visited)
+            };
+
+            // Check positions to the left
+            for new_pos in (0..hallway_pos).rev() {
+                if self.hallway[new_pos].is_some() {
+                    // Hit an occupied room
+                    break;
+                }
+
+                if !Self::VALID_HALLWAY_POS.contains(&new_pos) {
+                    // Not allowed to stop here
+                    continue;
+                }
+
+                let new_cost = (base_cost + hallway_pos - new_pos) as u32 * pod.cost();
+                queue_new(new_pos, new_cost);
+            }
+
+            // And to the right
+            for new_pos in hallway_pos..self.hallway.len() {
+                if self.hallway[new_pos].is_some() {
+                    // Hit an occupied room
+                    break;
+                }
+
+                if !Self::VALID_HALLWAY_POS.contains(&new_pos) {
+                    // Not allowed to stop here
+                    continue;
+                }
+
+                let new_cost = (base_cost + new_pos - hallway_pos) as u32 * pod.cost();
+                queue_new(new_pos, new_cost);
+            }
+        }
+    }
+
+    fn hallway_to_room(&self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        for (pos, pod) in self
+            .hallway
+            .iter()
+            .enumerate()
+            .filter_map(|(pos, pod)| pod.map(|pod| (pos, pod)))
+        {
+            let room = pod.dest();
+            let new_hallway_pos = room_hallway_pos(room);
+
+            // Check if the path is free
+            let in_between = if new_hallway_pos < pos {
+                &self.hallway[(new_hallway_pos + 1)..pos]
+            } else {
+                &self.hallway[(pos + 1)..new_hallway_pos]
+            };
+
+            if in_between.iter().any(Option::is_some) {
+                // Something's in the way
+                continue;
+            }
+
+            // Check if we can move into the room
+            if self.rooms[room]
+                .iter()
+                .copied()
+                .flatten()
+                .any(|other| other != pod)
+            {
+                // Scared of other pods
+                continue;
+            }
+
+            let room_pos = if let Some(pos) = self.rooms[room].iter().rposition(Option::is_none) {
+                pos
+            } else {
+                continue;
+            };
+
+            let new_cost = (abs_delta(pos, new_hallway_pos) + room_pos + 1) as u32 * pod.cost();
+            let mut new_state = self.clone();
+            swap(
+                &mut new_state.hallway[pos],
+                &mut new_state.rooms[room][room_pos],
+            );
+            new_state.add_to_queue(cost + new_cost, todo, visited);
+        }
+    }
+
+    pub fn solve(&self) -> u32 {
+        let mut todo = Todo::new();
+
+        let mut visited = HashMap::new();
+        visited.insert(self.clone(), 0);
+
+        todo.push(Reverse((self.estimate(), self.clone())));
+
+        while let Some(Reverse((_, state))) = todo.pop() {
+            let cost = *visited.get(&state).unwrap_or(&0);
+
+            if state.is_done() {
+                return cost;
+            }
+
+            state.generate_next(cost, &mut todo, &mut visited);
+        }
+
+        panic!("No route found!")
+    }
+}
+
+impl<const S: usize> Display for State<S> {
+    fn fmt(&self, f: &mut std::fmt::Formatter<'_>) -> std::fmt::Result {
+        let helper = |opt_pod| match opt_pod {
+            Some(Pod::A) => 'A',
+            Some(Pod::B) => 'B',
+            Some(Pod::C) => 'C',
+            Some(Pod::D) => 'D',
+            None => '.',
+        };
+        writeln!(f, "#############")?;
+        write!(f, "#")?;
+
+        for entry in self.hallway {
+            write!(f, "{}", helper(entry))?;
+        }
+        writeln!(f, "#")?;
+
+        for i in 0..S {
+            writeln!(
+                f,
+                "  #{}#{}#{}#{}#",
+                helper(self.rooms[0][i]),
+                helper(self.rooms[1][i]),
+                helper(self.rooms[2][i]),
+                helper(self.rooms[3][i])
+            )?;
+        }
+
+        write!(f, "  #########")
+    }
+}
+
+fn read_input(input: &mut dyn Read) -> State<2> {
+    let mut reader = LineIter::new(input);
+    let mut state = State {
+        hallway: Default::default(),
+        rooms: Default::default(),
+    };
+
+    let _ = reader.next();
+    let _ = reader.next();
+
+    let mut helper = |idx: usize| {
+        reader
+            .next()
+            .unwrap()
+            .chars()
+            .filter_map(|c| Pod::try_from(c).ok())
+            .zip(&mut state.rooms)
+            .for_each(|(pod, room)| room[idx] = Some(pod))
+    };
+
+    helper(0);
+    helper(1);
+
+    state
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let state = read_input(input);
+
+    state.solve().to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let state2 = read_input(input);
+
+    let state4 = State {
+        hallway: Default::default(),
+        rooms: [
+            [
+                state2.rooms[0][0],
+                Some(Pod::D),
+                Some(Pod::D),
+                state2.rooms[0][1],
+            ],
+            [
+                state2.rooms[1][0],
+                Some(Pod::C),
+                Some(Pod::B),
+                state2.rooms[1][1],
+            ],
+            [
+                state2.rooms[2][0],
+                Some(Pod::B),
+                Some(Pod::A),
+                state2.rooms[2][1],
+            ],
+            [
+                state2.rooms[3][0],
+                Some(Pod::A),
+                Some(Pod::C),
+                state2.rooms[3][1],
+            ],
+        ],
+    };
+
+    state4.solve().to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/23.txt");
+
+    #[test]
+    fn test_is_done() {
+        let state = State {
+            hallway: Default::default(),
+            rooms: [
+                [Some(Pod::A); 2],
+                [Some(Pod::B); 2],
+                [Some(Pod::C); 2],
+                [Some(Pod::D); 2],
+            ],
+        };
+
+        assert!(state.is_done());
+    }
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 12521);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 44169);
+    }
 }

2021/src/day24.rs

@@ -1,9 +1,159 @@
+//! Very input-specific reverse-engineered solution
+//!
+//! # General implementation
+//!
+//! The code in the examples is a series of 14 times this:
+//!
+//! ```txt
+//! inp w       -> read digit
+//! mul x 0
+//! add x z
+//! mod x 26    -> x = z % 26
+//! div z $A    -> pop Z (see below)
+//! add x $B
+//! eql x w     -> x = ((z + $B) == w)
+//! eql x 0     -> x = ((z + $B) != w)
+//! mul y 0
+//! add y 25
+//! mul y x
+//! add y 1     -> if x { 26 } else { 1 }
+//! mul z y     -> if x { z *= 26 } (push z, see below)
+//! mul y 0
+//! add y w
+//! add y $C    -> y = w + $C
+//! mul y x
+//! add z y     -> if x { z += w + $C }
+//! ```
+//!
+//! `$A` is either `1` or `26` which we can translate to a bool `$A == 26` for convenience. This
+//! simplifies to the following rust.
+//!
+//! ```
+//! fn validate<const A: bool, const B: i32, const C: i32>(mut z: i32, digit: i32) -> i32 {
+//!     let x = (z % 26 + B) != digit;
+//!     if A {
+//!         z /= 26;
+//!     }
+//!
+//!     if x {
+//!         z = 26 * z + digit + C;
+//!     }
+//!
+//!     z
+//! }
+//! ```
+//!
+//! In human terms, `z` is used to hold a base 26 number. When `$A` is `true`, we pop off the least
+//! significant digit by dividing by 26. Then, depending on whether `(z + $B) % 26` is equal to our
+//! digit, we push `digit + $C`. Ideally, we should pop as often as we push in order to arrive at `z
+//! == 0` in the end. The input contains 7 pops, so we want each of those to not push.
+//!
+//! To solve this problem, we use a backtracking memoizing algorithm, where we cancel every sequence
+//! that fails to pop at some point. A pop is failed whenever we execute a validation pop where we
+//! can pop if `x` happened to be set to `0` at the time of the check. We can memoize this over the
+//! running value of `z`.
+//!
+//! This implementation probably doesn't work on other people's input; to fix it, you'll want to
+//! update the `parse_step` function. Good luck with that.
+use std::collections::HashMap;
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
+use nom::branch::alt;
-    todo!()
+use nom::bytes::complete::tag;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::separated_list1;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::read_input;
+
+type Cache = HashMap<(usize, i32), Option<i64>>;
+
+#[derive(Debug)]
+struct Step(bool, i32, i32);
+
+impl Step {
+    fn evaluate(&self, digit: i32, z: i32) -> Option<i32> {
+        if self.0 {
+            (z % 26 + self.1 == digit).then(|| z / 26)
+        } else {
+            Some(z * 26 + digit + self.2)
+        }
+    }
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
+fn parse_step(input: &[u8]) -> IResult<&[u8], Step> {
-    todo!()
+    use nom::character::complete::i32;
+
+    let parse_pop = preceded(
+        tag("inp w\nmul x 0\nadd x z\nmod x 26\ndiv z "),
+        alt((map(tag("1"), |_| false), map(tag("26"), |_| true))),
+    );
+
+    let parse_a = preceded(tag("\nadd x "), i32);
+
+    let parse_b = delimited(
+        tag("\neql x w\neql x 0\nmul y 0\nadd y 25\nmul y x\nadd y 1\nmul z y\nmul y 0\nadd y w\nadd y "),
+        i32,
+        tag("\nmul y x\nadd z y"),
+    );
+
+    map(tuple((parse_pop, parse_a, parse_b)), |(pop, a, b)| {
+        Step(pop, a, b)
+    })(input)
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<Step>> {
+    separated_list1(newline, parse_step)(input)
+}
+
+fn optimize(
+    current: usize,
+    steps: &[Step],
+    digits: &[i32],
+    z: i32,
+    cache: &mut Cache,
+) -> Option<i64> {
+    if current >= steps.len() {
+        return (z == 0).then(|| 0);
+    }
+
+    if let Some(&memoized) = cache.get(&(current, z)) {
+        return memoized;
+    }
+
+    let result = digits.iter().find_map(|&digit| {
+        let z = steps[current].evaluate(digit, z)?;
+        let result = optimize(current + 1, steps, digits, z, cache)?;
+
+        Some(result + digit as i64 * 10i64.pow(13 - current as u32))
+    });
+    cache.insert((current, z), result);
+
+    result
+}
+
+fn parts_common(input: &mut dyn Read, digits: &[i32]) -> String {
+    let steps = read_input(input, parse_input);
+
+    let mut cache = Cache::new();
+
+    optimize(0, &steps, digits, 0, &mut cache)
+        .unwrap()
+        .to_string()
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let digits = [9, 8, 7, 6, 5, 4, 3, 2, 1];
+
+    parts_common(input, &digits)
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let digits = [1, 2, 3, 4, 5, 6, 7, 8, 9];
+
+    parts_common(input, &digits)
 }

2021/src/lib.rs

@@ -92,7 +92,7 @@ pub fn get_implementation(day: usize, part2: bool) -> Solution {
 
 #[cfg(test)]
 fn test_implementation(solution: Solution, data: &[u8], answer: impl ToString) {
-    let result = solution(&mut &data[..]);
+    let result = solution(&mut &*data);
 
     assert_eq!(answer.to_string(), result);
 }

2021/src/samples/23.txt

@@ -0,0 +1,5 @@
+#############
+#...........#
+###B#C#B#D###
+  #A#D#C#A#
+  #########

2022/Cargo.toml

@@ -0,0 +1,27 @@
+[package]
+name = "aoc_2022"
+version = "0.1.0"
+edition = "2021"
+
+# See more keys and their definitions at https://doc.rust-lang.org/cargo/reference/manifest.html
+
+[dependencies]
+anyhow = "1.0.66"
+clap = { version = "4.0.19", features = ["derive"] }
+itertools = "0.10.5"
+nom = "7.1.1"
+
+[dev-dependencies]
+criterion = "0.4.0"
+
+[profile.release]
+# Keep debug information in release for better flamegraphs
+debug = true
+
+[profile.bench]
+# And same for benchmarking
+debug = true
+
+[[bench]]
+name = "days"
+harness = false

2022/README.md

@@ -0,0 +1,20 @@
+# Advent of Code 2022
+
+Another year and another Advent of Code in Rust. Because last year went so well, this time we'll be
+aiming for a total time of under 250ms.
+
+```console
+$ target/release/aoc_2022 --help
+Advent of Code 2022 runner
+
+Usage: aoc_2022 [OPTIONS] <DAY>
+
+Arguments:
+  <DAY>  Which day to run
+
+Options:
+  -t, --time           Print time taken
+  -2, --part2          Run part 2 instead of part 1
+  -i, --input <INPUT>  Read input from the given file instead of stdin
+  -h, --help           Print help information
+```

2022/benches/days.rs

@@ -0,0 +1,46 @@
+use std::fs::File;
+use std::io::Read;
+
+use aoc_2022::get_implementation;
+use criterion::criterion_group;
+use criterion::criterion_main;
+use criterion::BenchmarkId;
+use criterion::Criterion;
+
+/// Number of days we have an implementation to benchmark
+const DAYS_IMPLEMENTED: u8 = 25;
+
+fn read_input(day: u8) -> Vec<u8> {
+    let input_path = format!("inputs/{:02}.txt", day);
+
+    let mut buffer = Vec::new();
+    File::open(input_path)
+        .expect("Failed to open input file")
+        .read_to_end(&mut buffer)
+        .expect("Failed to read input file");
+
+    buffer
+}
+
+pub fn benchmark_days(c: &mut Criterion) {
+    for day in 1..=DAYS_IMPLEMENTED {
+        let input = read_input(day);
+
+        let part1 = get_implementation(day, false).unwrap();
+
+        c.bench_with_input(BenchmarkId::new("part1", day), &input, |b, i| {
+            b.iter(|| part1(i));
+        });
+
+        if day < 25 {
+            let part2 = get_implementation(day, true).unwrap();
+
+            c.bench_with_input(BenchmarkId::new("part2", day), &input, |b, i| {
+                b.iter(|| part2(i));
+            });
+        }
+    }
+}
+
+criterion_group!(benches, benchmark_days);
+criterion_main!(benches);

2022/inputs/03.txt

@@ -0,0 +1,300 @@
+NJvhJcQWTJWTNTFFMTqqGqfTmB
+VwVzPldRZVLVRmfsvfjvqfmm
+ZDPDHZHVcvDhbvnv
+FHHwHBzzVCWWmmCzCPrVmgBwbLTtRFFbbbttRGRLjTcLpbbT
+vhZZvdsNSdSMdNvjncppCLcLnGnj
+CDZZsNZMZqdNSdlNZCqrzPHDzgrgzwVVWwmwwm
+ndlndntsFJntFvccLjjLrjBShcBBfc
+GpCGHzVwmmzqQWSSSfWHBhQL
+mpCMGGCZVzVwGGVwmJsZnFtZnTSTJtdsvl
+nCnPDGmDNmVCsVQDmGSWqvzchWSjjcWGqS
+gTnBRLpfTRnrTdZgdLfRdrThvqcvWWhFFWvcFSSgjqqzjv
+pfZfTMwrbLTTfsbmQtlVtHHnbs
+wNdSdsbTvTZMTvTv
+rrdRWdWQhFVdHWBGWQmmmnnMvCfmnhvmCmtZ
+rJrVDRWpGddpbSlNSlspPP
+chTNrthMMwWMTjfsmRzZszJpwm
+BLnFFCngbcBnbbldDlpRjGpmsCzGsGsRGmmG
+dqvnvlgbqtcPPMhH
+QcLNqZbCzJDQBJJRpwzRpdnRldgnpf
+GmmmvVGsHrWffrlwdCWd
+CMsFVVFjCmFStGQbbLZNBbJBcTjc
+LQVggbQvcLbQLHgvVLhWGGsChssrMWfzGccc
+qDnRTTRqJttPfWMChJhGslWlzh
+qRTRwPBTBtRZdnjnqqqnQVbjbNLFbbfLgVmgHLQm
+cZbzwCwZPlJcMLrNSNfHWNBBNZ
+vsQsDCqtsDhmtjVrBNWNjBHrhr
+TtDTGnvTlgbbRCGg
+BgBlplHlsgNNsJlVpBtPwJhMPRRQSSttRtSP
+bvhTnmdFTzddStwStQRddt
+ZnZDLvnvqZzbbhFzzmTbnFsVjVlNgsCCNVsVLpNWVgsB
+TdptqrrcVGhhzFtw
+DRnSfwJlDmmDDVGv
+RCSQNSCQZndwbcMqQrBB
+wvRlrlwVwwqzgbZRdCJBWfmdzCWfBdhf
+cFcsQpNtLLsGTtNGpMdPmDdPBmmBvJPWvDtC
+TpjssTFFvLLLcFFQpwbwwHngjHRrZRqZVH
+mqqddrPPcPmqPDlrQnjTrbvMvbHzzsjjpTvz
+gtBWgGgVhLGWHzMDztzstDHj
+hfWRhBBNBGgLNQDPwdNPcPdw
+LhQzdhhbTzpMhddhhhTzhnZcBFllHZFtrrHZHMHFjlHr
+mwwssqDvjptrvplr
+NCSgVDPDwmDgVJVpLfTznQJdhfLhnhQQ
+GzjzDhjhhZzcrRgQCBjBPBBjQCgT
+vHHHmntsbSgLwbsSmNHbwNbvpqPCBVppCpFTpTPTBtqWBCqV
+NJbwNSwdndvmvwhGhgzcfMcDJfgJ
+GncgDvvcMGnttjDvrgRRFSZZLZFWdJFJwGQwZBWZ
+bPqpChPfsshfZZBdZdLTFZ
+lNqqsClmbsNlPbHqPsmblmsrHdvdMngcVrjggvrvggRDcn
+bDvtgVVVpMQvjQWmQL
+rwTflmlfZJBBdQWQWjQqdM
+HsJJmZZwscHrwTrcRbzpcbPgtCSbgz
+CsCsRvshMjpbqCqf
+ncblgDBgtDmmmTlBgwlgbHHqMFHLqPDMHPHHpqWfFM
+TcBctSmTZTtSTzsZvsvJZRsGVb
+znznvngttwltzlLwhtThHbqHPvNbNHSSHmmNWHjP
+FBcLrRMFQpPqpPSpqHHW
+fRQMJZJfrcMcMVrQJJftnwCzVCltgTnstTVnVL
+MfLlRfCMrLzRlQgwNqQFcsGd
+jtTjjBTvbdqcGjqFcj
+vvShDSBDppzhCmzq
+plWMptTvfrnncvcRfwqzqLGhzhzThNzNNJqD
+jSdSHFPQQbdPCQCssjSbBmhJGNZZNGNqqJNBlJqqLh
+VCCCVCQgjdddjCgljCjbbwgRRttgrpftfWrgvpwpnf
+MWlbBcPjjvvjPWWMPqgRQZfJZDGGbRZJffQQwh
+HrHrnncHpzrJQJfVDQVR
+zzsSTtSTLzsspSdtTmHHmpmtFgqcgPlgFqWBqqqBMdWWvFlg
+nSqBbJbqlnBBClVZcMgZVgcP
+FQwrwHrRwWWFBRPNgNgcCGZZZC
+rWFWFTwpwwWzHrnDbfJDLDbBBbbz
+BMmNtLMMtFCNFNMvvLmcndpgcdgppPrgrGPPrgJD
+WVWWhbTtVnGpjrrPhr
+HWssSTHWfRHRsQQFLvfvFFCLCNMNlt
+sTmDsQffVrrLCjTFltTFWL
+BnwwQBJbJndMMRzMwCLlWlLWWCWLLtRlWF
+cqqBMcMqwnznMGzcvDmQhrvssHmPDVssrP
+pQGQGJDDrDVJbbfVzvvgPcCZwhZhncscZWWc
+SqMMlBBljMmRlchhPTqThCZnPs
+FMjMBmjRNFHQJJpHVhVDhG
+tHNNdBdNtBBBMgsMpsZm
+wVPzVvbwqzhrVqvjqzzsZpDsZDsZmsCPCgZgCM
+bVbvLThvvbrWqHmmnJLdHdJQLn
+PzTspPZpdLLDZTplPLpPDpvbfhnqNvqzfvNMzQQfNwnQ
+GWRHmjmFWMMSnhbhHw
+JWWcmtBrBtWBFWGJpsgTgldhLVLpJl
+DwLMDzLMhvMcwvgdVqWWlCVgvlqF
+TTSBBRpbStHZVgjWFldjRVlV
+SnbTBdJBmnpQzMPDMcMznr
+nNlMNBPPNtJQnbZhZsgSbh
+czzCjcwTdvSbgQNcgNQq
+VTdNdGDTzDTdlFFPtBrtLtDr
+FMbbfMlzvFsmgVZmmg
+SrNTHGmdSQDqLhtQhhgggs
+dRDTSDPPcHRdHGDHlwJBbmwljmMcfjbW
+sQgWLtqLtWhdqlpNZRpG
+blTHTjlvTCJnJvRZdGGhHHGZhFGV
+CCDlJclnCmbrmBMgcwcLWtcBsB
+vqPWWvqwwCFvFZfZPRFRrcGQrQwsDrNcrwnbDNcQ
+LVgJLSBBVtzTLzBMmTMJmLnnDNQcrsGbsQbNbrbDjs
+zggVSmmhVdfqFhvHWG
+WwdndGGmmmLwwwmRwWSncLRnZqZqhqZthBtqtBqZBgtdtvMH
+FfHHzlQQDsFzzrNsVTfttZvTvttTqqtbqb
+lQjFDNQFPjCsVCCDjGCwwSGGnccwcHppGp
+mrjggcFsFMjdjZRpSZpn
+NCqfLCFNbQPzPPlPzNfSRTRZdSdWWwndpqRSSd
+vDvzzbPQFNCFtllLLNMBhMcDHGBGMggMmcBc
+jhjlBvvnjbtDNPjtSjBDBbDNgHggrQrhghRQrqRrZcRwwqVg
+pLdTMsWdLLmpMdqZZdPdVqZgHPwH
+WLTCGmMLfPSlbGjlnnJD
+gtbwhgHbHgqqbgQthgQLtZZCRjMcjjnRnrRNJmMRJrNhRc
+bGWVTTvDvfpVFFBpvvVTdRDMJcrccCrJnMRnNnNCcc
+FVWTBsdvdTzTBFWssVQtLgSQtHqqPzPbqHbw
+dlzrPTSSjSrllzWhsvVmVtTRTWtf
+bJMpLGcqGhNbJQttVQmmvRWWsp
+qLbMwqqbGHFGzrlZrjhPHCrj
+rNrrffVlqqrfLlPpltcBBTTGRzzZRPRsBTcJ
+msbsmWSsMmQwjdMbWMhMhQmcRZRzGjTBGTBcBJBjCHJGcC
+FwWbvdhbmrsFrfrgsN
+rHjrQHdhdQrvSddcHWLssBSVVpBSWWWWWf
+JNfTGtqDwVWBMBMpwM
+qlltZgfJFvcRgcRjvc
+CqfcwfDqwwmRnnqmRdNRBTRTRrdGdNpTvF
+WVbzsZszBbrsvpdMpdQM
+tJhbVZHWLLHDgnSwnSSgHB
+TZCqqlTsqpZVVsZQJSBSLpLmppnJzmFz
+brSgNtGjjRjRRjDddDtrRJcJJbJmmwcmBmnPcJFwFB
+jgdRtMjNNjfqlMvShvSZSZ
+dJTdqCwMNCgqTQllGBdlGBmmmZ
+fcVfVcnbVfrwDLWVfncZBQPlBHRGljLZQjHGQl
+brwnnfSFDvfzCTqFzgMJTh
+njnsPBjjsrrnGLnbTTjGvcldQPCMllNzMvRQPCdd
+ggZgfZtmZVpqZqZWDgFmgqfCcQRcRcWhQcccQddMcvRQdQ
+tfqgggVgHpDwDtfwbGLJRjbLjsrLTj
+JmrfrmTlDWTfgQCdHCdpqBvQdD
+jsZtVzNsSNVQQHnBlVQR
+PljljFjPljSsLPtFLTTgTcFrrfMJmrrmrr
+hmGcmmndhmGnfmtGnDzFLwrFJQsQFzNFrNJG
+ZSqPlSWcWlbgqWVTVWRVZPrjQqjzjFNJzLsNJsLJNqNL
+RHcWTZbSMMMPgZcWgSWPPbVMDnBffmtdpDBddfnnvmCdfC
+vSJvsbFfJfvqCsTHJswssJnLTZjjhzrrzLrzLMrzhdjM
+pBNQDPcpmWDcBNgMMnZPVjdddnndhH
+QWlDgmpmgDBlGRgDDgffSqwSwGCwHfvqwSFJ
+jvlgvMJclPdGdtdcjMVmMHbFHFVHWHbZHZ
+CwhLzLhzQpnqfpfqDVHCHbsbDFZDmHmj
+LnBzfQjSzQrPvJvdSSrr
+wpcvcsqclDCnVCVvWfnZ
+BLRMRtbnbbBLNCjNCjVVZhbC
+rFgMPSRnrRpmqpJwqFDs
+LZQNQbMrZppLNLQplvlGLNvVmmmfjbwVCfjbwJwCmBCwfj
+ShTPRFtTHZPCsnwswsFwCF
+WtHRPdThSqZTRtDqtdRWTdpGDLLzrNczvzMGLlQLGDDM
+hdcffBvldjhCMljqPwWwWNwWdwqHZr
+LtQmbQRVsZQZMZPQSN
+tmMRsJMpDhjJzJhv
+wNQCMFCDQDBmrHmmRWrrHN
+SShLnfqpcqpSZSfrzJvRVrvfrrJH
+cRpqdGclpScltTQQtsFQMQsTCT
+NCjggZmgfBgnBmgWbcwcTFctcWWfvb
+HsDGthRGrtppSQpbFFJTVcJdFbTRvd
+rPDGhDDrSzZLtzBLZMCB
+RsBBMBsCBlFFCgRsBJzlMjMPNSdPhSrSrzLbmSDrDNmDSd
+pZHZZJpGHHHpTTHvTncZqVLdqLbhLrDLdhrSLLbLDDdD
+tGtwnJccvCtCffMBgt
+wbddvVjfwPhbjjbDbbvbjvTNCNmfHZfpCZRJNzCmJmnJNC
+BslcLtclZWsZJWNrRRNRpRmR
+BSLBlScGtFMcssMBBFGLlQZTDZQjPddVwwbTdvvdhTZb
+NSZHzmLZBnzHmLLzLSntDttDDtddhDtttDWW
+QgfjsrrvNNJwtMddcvcvtq
+jrfgfQpQrTTVLSNBClFV
+GQWcWWPPQRcrJQNDdRcDmmLCFSnqNSmqhCNvFnql
+zHfwjzpMjwZmCLqvvnlljC
+ZgtVZBtHHZtgQGgPrbPRJdPv
+TWdWpJTJTdgLWfWLlLFLrfrgBGsNqhGslBGHqSNqqBNshnws
+ZpQmjzbZZCjZCCCPZtttRCCwsBnHNssBHbShsshHqsGBqN
+RDRRPpPCzmZCtRpVVJFrfTfWFLLJggJrDv
+pDDFlglsvFMgntlTMMqNffmTdfddRM
+jhGJLVCHQpHGQCCzLjWdTTdZZdNdcRWNccWfNN
+jQjSGjrjCQLhzVSLSCSHGDpngbrnDFtFBwBglBnBvg
+wsLzstsgszcpcGLHGpcgcghlDBvQvjQvbFbQCbJBtCCJJv
+mnSqRSSqSRThWRnmWWRSJDFTFCFCblbBCFQFCjFj
+rZRRWqSSdZZfMVnZLspPsMgHpzMhHGPg
+mwHrCLSWWwrsHCHDDsVrsmhfFZFnSSBlFlgZbbgBglbggj
+GJdpcRtGJvNRdcPtdpJJdbQZfjfQBlnQBjnBtbfFnB
+qcPpqqzFzJqvPVCCmWrVwhrWrz
+jjMbvbhDvnRjNRGMmjbMZftSSwwwthJSffStctcwqd
+lTQrVlpCVvCcfdcSJqLVcw
+srHFWCHrFlrHlrsBsprljjRmDZZnmbDngNBgbNZv
+MgTlQJlTQJZWpgLrRssrVqqqpRts
+bBNbbzSSjMBPjzhMjsPtRVVRVPRqLttGGs
+SjHBbfjNCDfjZgTlZdMJnDJW
+lpThgTwtplhghgwhThqnnrdZctSZSjSZcRSRfbdrrc
+RBVBGvmBmfdrcvrbbr
+PmVGNGmmGRLLQwwLqTnglQ
+nHwnBwBTnFHQwRsMhwghmzcm
+GtprdCpdtqWdbqbrfdnPPszsWmRzRnShPszS
+dGptbCfCrlnVDBJNLDLLVDLQ
+CZtCjhTndCzqbCNq
+dwpGvpsmwGslDszrNNrzqDMzWMgJ
+vmcGccvpBVPTVTjTdTTTdZ
+jWZhvZLjZfCZDwrDrSSzJGhVdJccscGsgV
+blMBlRqqqgSJLBLcsJ
+blmHLmFMMMnRqLmMMFqHmfPDfjQDnCDDQrZvfCjvDr
+rnvnHrDLFZmMFLvrHQBMGQggBztzglplRl
+sbWWhdNzsshsfhcsjJJPPbWdtQGVGllRTRjRRgBgQlpRlppB
+PPCCwNWhPhNfWCzbqmFnDFFnCDLSrvZS
+GChNjwWlWJWTJZBggvdgnQgdhdnd
+HPsHfHHrpHDpFFrcSfsfpCMmQdntLBMgtmtBgDdLLC
+SqpPscpPzpSWzjlCjjCGjl
+nvgLvcLgvgvngbLprpJNTDCCRNVJrNPlDDTV
+WZsMtsffGQtMzWFqFmWmWsVNJNlDwwCDVRTwJlCCDVLz
+BQfGZGmmsMWFstWFmfMsfBccdncbpbSbvbbvHnLbpc
+tsmDsvswNZmcZTccfh
+zCTpGCbWBRWFWHGRFZJbMbJfnrhnhfMnnZ
+TzFGFBRLdpHHNNQddDQDvwQN
+fhBBpJgdHddjZQfmVmNzNNLmFN
+qvMRrvlbwqlbTTMBMvLssFNmVzzwFDmLLzVD
+TRSRWqRRMcBHhGHcdGgPGp
+lSjHmtmnpHStblnpSlHSrtmMzLWzqzqCZDDTzTTWqMFqCqVV
+sLRLLfPPRQfCTqqVVqFT
+dNJgRPNQNsJJhBRvdJvQvNNsjSrrSmrcctpbpHtBrBjLjmSH
+nwFwpppjfwSlpLTsqsTgNshhjM
+ccBRGvtsmgGNPqNNGP
+BCcJHvssdcWBCVmVHSSrZrwVzblpwbzZnf
+rcfQRrBPPczjcRBctZDNlnVNHbgZGjVDjN
+TvMsFJGSFMhJnNZlwVVnDNTZ
+qhSqqmqLCLhFdJLqSvLhmQRQRWcRPczPtzrCrWGRBp
+JVhdPhsFPFqLDBHVdHLPvhHDCMwcgJJwbwRgnnCMbwGwcmGC
+fzjzpTZTQQQLwCbgGgbMmQcR
+jzNpTzfSZtfNSWZlVVtdFFFDHHqLHVqv
+TwSNnSnSGVTpNppGlPTlTcVqQrRhVBqdqBRqZqQZqQ
+DcDCMfDbCMHJdrRBqbdjRBRZ
+gvftMCJHcHfCDmDLgfMmMmmWlwWnWsTTwlGTlWTwppNlGL
+pbGMbllDQPhhWWQDpPgVGlMCvRRrQLcCCcfBBQzLBcvQBv
+wqnJjSmjrstdqwwFBLcRsBRRszzLFC
+qwdddTJTdHtjndqJqHZHmwVWGpDbGTlbWWpWWrPGhhhM
+WGllqLjjLCpSffmBmvfpHs
+dnrQwZzRTdZwnCThdzzFTVmcBHBJBmsHfBPHcfvcSVHs
+QgQrzCdrTRCZzrZLbjGLqNMWGgNNLt
+sgPnhPPTTPTTwlJfwNHlqcfs
+LMCpFbLLbRpMGbMcCFLVlNlNqrHqVfbHHwNDwr
+GjBcCCtWMtMRZTSvgWQTngvg
+BCMtJJMpRDlMMvBJBBnfjtcjPhPmZgnhgdcf
+NrsrsqFNvrVLVGVrsHsqFgfmcPGdcmhfjdPgfjcnZd
+zFTzsNqHqFssLVLQqNTFbsBDwCCwvWlDwRMRCTRBDMDS
+zQtLgvggSRtgvVRtLvvnzdnjnGwGdmmrlpnlGz
+JssBFpqsDqPNnlWWjrrjqrnj
+DHDFBNDfPbJBsFHNMPvpvStQvMRVTtgVTVtv
+FvzttFvBTJJzLbvwhCnnVnWwjCnBNC
+mQdZgZPDPdPPSsMSQPdZgCwVGmnwnWpGnGhqNWjWCG
+ggdDgfQSdcjtFHjlLJfF
+ghcgScNNSsCvGSzmpVFlZbrzcFcV
+MWWRLRqqqdQwTtLjjmqMlFpFlzVnbFVDwplFzlDr
+LHMHqdHWjdQMdMtLHHLtWjJRsGCGSNghmSvPBJBNhsGfvfGP
+CbVqqqDbcbMHnnDqcCbrRFCfBvvwGjzrBwQGzrwwBjGwBQ
+sTPmpNWdWPTJssSSLPfNljjBvflGtjwwBzMG
+mmWgmgSZLTLMZWpnhqZbhFFCnhqnnn
+QQmjmZqnmQrfTZlbbcVbBcfbHfzf
+vpdSNShNppFdSRtdGBqvJBDlDzqbPPHVBH
+tRNSNRFhNpSRhFRMFtGhRGswLZZsZqWnmrmZwqwsTZmmmQ
+gGWCllFCGWtGGWdlGlWNZdwpnnSbwpMvpphZpndn
+RsshDDLcQVMSJQwJwnvw
+HVPzrPcDNhPFGhPC
+jtHQGHjGGtdTLjnqTQlmvRPRPBBwRBnFPPWP
+hZbzNzVrczZzcbNssVspZZVvBwbmPmJPWmvbBRvPlmvRJF
+fzNVDsZMhzpVhpVhlZcMNfcDDdQTLTjGDTCqGCjtSQHdHL
+GrbFggGrTrzSrgfwJjdTmwmNJZJd
+VMPQplPDptchwdsjmlml
+MqMWtBDPPWDWHQtvqQtWPjbzCGLgSBgGbzgrzFgnnz
+fcJccCcwcDfcpbRnCfWJnQJqtqtqPQdsGdgPsgTQqg
+LSjVMhzSFFrljdNbltNGtgdqQq
+MMhSHFFMLzBWDcHHcfcHwb
+rwmWtJWMwSNRJMtwNmMrrSsmtTjjlgqnTqZZZPlHnTngTTgn
+BGqGqqFBFggjjdGHlj
+QDhhLbDQCDFMNcmhRhqJNW
+BnRnRvMnLGLSCHvvSnlRfWbbTNQJsJsbNbJTBfQT
+tzMmmMwjhcpFjDmMcptrcjzFQggfQPTsWsfgNbbgfhJbPhQT
+FdzcrtDwDMtcwtFGRZdRLvdnHRSZZv
+HVpsSpvjpNjsBmbGFBnMNnDM
+WRRWhZtfrVtLJrBZMnDmDbnZBTGF
+thhPLzWzhzwPtLRLWrQlpPvvClcVcCppSvpl
+lZPbhnZLRPnnPZZPdlGMBWcBMgMQHBBcvvvzBL
+jpFjmwwwCDDbsjvjjgcvQgcNBQ
+rbFmppbwhqhGRGZr
+ggrLwFgWCBwbMWBbFwLMgNBZdmZHclJPllnJlNRPmSNZRR
+ppszzDfhDfhsqpnvDVTfGpSPlPmclHcdRcZmmmdPPGSP
+pvtDDVDVpqDfzDfngBLCwQrgCtCwFwrg
+pbGjFFGGDjpbsGsmNhNFNRBBBtRhhhHv
+JnczJVCvwWJvhPgghgNtNtNJ
+nwVSSzdzzqSpvQSZQG
+mssLLttQrsMrMzLCRmMmrrSQpvWpDNlBTBDlvNTccDQl
+HdHJwJqVPwHnqJwbjJbGjnSgSTWPpNgWWpgBBgcvDWWN
+ZHVwVZGwwdndqJVJqfHbGwnwrRLtLMftMvMMRrhmLMthhLmz
+RgHGLbTqlZlPRZPHfvvfZttJnvfvjnzr
+sVcChDVDccwNhhvjTvVzWJjnzFff
+mpNcCMTCGmLqBLGH
+wVJwHJHVMtMpBmDDWPQVPWDGDD
+zCrlZzCblBvnCDWNGLmvGDLPNG
+dqZglgbzrzbbgZqzTFSBHHFJSSSfjjSMfwhj
+NMWJSjLMCnHHNMNNHWCHMbVVGBPZTrPVPBVDrBSDGTTr
+zvttlFpgdtldwwvftPDPTWQdBZrsrWrGBZ
+hFlFmhRFvfCbmWJWHcnj

2022/inputs/05.txt

@@ -0,0 +1,514 @@
+        [G]         [D]     [Q]    
+[P]     [T]         [L] [M] [Z]    
+[Z] [Z] [C]         [Z] [G] [W]    
+[M] [B] [F]         [P] [C] [H] [N]
+[T] [S] [R]     [H] [W] [R] [L] [W]
+[R] [T] [Q] [Z] [R] [S] [Z] [F] [P]
+[C] [N] [H] [R] [N] [H] [D] [J] [Q]
+[N] [D] [M] [G] [Z] [F] [W] [S] [S]
+ 1   2   3   4   5   6   7   8   9 
+
+move 7 from 6 to 8
+move 5 from 2 to 6
+move 2 from 4 to 1
+move 1 from 4 to 5
+move 5 from 7 to 6
+move 7 from 6 to 3
+move 5 from 9 to 2
+move 6 from 2 to 3
+move 2 from 7 to 9
+move 20 from 3 to 1
+move 11 from 1 to 6
+move 1 from 9 to 8
+move 3 from 8 to 2
+move 8 from 1 to 5
+move 10 from 8 to 4
+move 7 from 6 to 4
+move 1 from 8 to 3
+move 8 from 1 to 7
+move 16 from 4 to 8
+move 1 from 9 to 8
+move 1 from 5 to 2
+move 4 from 7 to 4
+move 5 from 6 to 7
+move 1 from 6 to 1
+move 8 from 7 to 4
+move 1 from 6 to 9
+move 12 from 4 to 5
+move 3 from 2 to 5
+move 1 from 6 to 2
+move 1 from 3 to 7
+move 1 from 3 to 2
+move 1 from 9 to 3
+move 1 from 7 to 8
+move 1 from 7 to 5
+move 1 from 3 to 2
+move 4 from 5 to 7
+move 5 from 5 to 7
+move 1 from 4 to 3
+move 1 from 3 to 9
+move 3 from 1 to 8
+move 1 from 9 to 1
+move 2 from 2 to 1
+move 2 from 2 to 7
+move 8 from 8 to 1
+move 3 from 5 to 2
+move 8 from 7 to 5
+move 7 from 1 to 3
+move 3 from 1 to 7
+move 1 from 1 to 5
+move 1 from 3 to 7
+move 7 from 5 to 8
+move 2 from 2 to 8
+move 1 from 3 to 2
+move 1 from 2 to 4
+move 1 from 4 to 8
+move 13 from 8 to 1
+move 13 from 5 to 9
+move 2 from 5 to 2
+move 7 from 9 to 3
+move 12 from 8 to 3
+move 4 from 9 to 3
+move 1 from 3 to 4
+move 2 from 2 to 3
+move 1 from 1 to 6
+move 1 from 2 to 3
+move 1 from 5 to 9
+move 7 from 7 to 4
+move 10 from 1 to 8
+move 1 from 1 to 4
+move 1 from 9 to 5
+move 2 from 5 to 1
+move 1 from 6 to 5
+move 3 from 8 to 9
+move 5 from 4 to 3
+move 4 from 4 to 1
+move 7 from 1 to 6
+move 2 from 5 to 7
+move 35 from 3 to 4
+move 4 from 9 to 1
+move 19 from 4 to 8
+move 1 from 7 to 6
+move 1 from 9 to 2
+move 10 from 4 to 5
+move 2 from 4 to 7
+move 3 from 4 to 3
+move 1 from 2 to 8
+move 1 from 1 to 9
+move 3 from 3 to 6
+move 4 from 8 to 6
+move 4 from 5 to 2
+move 2 from 8 to 3
+move 3 from 5 to 9
+move 12 from 6 to 1
+move 8 from 8 to 6
+move 2 from 9 to 1
+move 1 from 4 to 1
+move 1 from 3 to 8
+move 3 from 7 to 8
+move 2 from 9 to 7
+move 1 from 6 to 7
+move 10 from 6 to 8
+move 4 from 2 to 5
+move 1 from 3 to 7
+move 7 from 5 to 7
+move 13 from 8 to 1
+move 29 from 1 to 4
+move 8 from 7 to 8
+move 1 from 1 to 3
+move 3 from 7 to 6
+move 1 from 1 to 9
+move 15 from 4 to 1
+move 1 from 3 to 6
+move 10 from 1 to 6
+move 10 from 6 to 7
+move 1 from 4 to 9
+move 1 from 9 to 1
+move 1 from 9 to 7
+move 6 from 7 to 8
+move 1 from 1 to 6
+move 5 from 6 to 5
+move 21 from 8 to 9
+move 5 from 1 to 9
+move 2 from 9 to 5
+move 3 from 5 to 6
+move 3 from 7 to 9
+move 4 from 4 to 6
+move 6 from 8 to 7
+move 6 from 6 to 3
+move 2 from 7 to 9
+move 1 from 7 to 2
+move 6 from 3 to 2
+move 1 from 6 to 4
+move 4 from 5 to 9
+move 1 from 4 to 5
+move 9 from 4 to 6
+move 7 from 6 to 4
+move 10 from 9 to 2
+move 5 from 7 to 5
+move 10 from 2 to 7
+move 2 from 5 to 4
+move 2 from 5 to 9
+move 4 from 9 to 4
+move 1 from 8 to 6
+move 7 from 7 to 2
+move 1 from 5 to 4
+move 2 from 7 to 1
+move 1 from 5 to 7
+move 3 from 6 to 2
+move 4 from 4 to 5
+move 1 from 2 to 7
+move 10 from 4 to 7
+move 3 from 7 to 3
+move 17 from 9 to 4
+move 1 from 1 to 4
+move 1 from 1 to 5
+move 5 from 2 to 7
+move 1 from 9 to 2
+move 5 from 4 to 8
+move 2 from 9 to 7
+move 4 from 8 to 1
+move 3 from 4 to 8
+move 1 from 2 to 5
+move 1 from 9 to 2
+move 6 from 4 to 8
+move 3 from 7 to 5
+move 1 from 4 to 9
+move 1 from 9 to 1
+move 3 from 1 to 9
+move 4 from 8 to 5
+move 2 from 9 to 8
+move 4 from 2 to 5
+move 8 from 7 to 2
+move 5 from 8 to 5
+move 2 from 7 to 8
+move 1 from 3 to 5
+move 1 from 1 to 2
+move 1 from 1 to 6
+move 2 from 3 to 6
+move 5 from 2 to 8
+move 4 from 7 to 1
+move 7 from 8 to 5
+move 1 from 1 to 5
+move 3 from 8 to 3
+move 1 from 9 to 3
+move 7 from 2 to 3
+move 2 from 2 to 8
+move 2 from 4 to 8
+move 1 from 8 to 5
+move 1 from 1 to 4
+move 2 from 4 to 7
+move 2 from 7 to 1
+move 3 from 2 to 3
+move 3 from 5 to 2
+move 1 from 8 to 3
+move 3 from 3 to 2
+move 5 from 2 to 1
+move 17 from 5 to 8
+move 9 from 8 to 1
+move 11 from 3 to 5
+move 8 from 8 to 5
+move 2 from 8 to 5
+move 16 from 1 to 4
+move 13 from 4 to 7
+move 6 from 5 to 2
+move 2 from 4 to 8
+move 5 from 7 to 9
+move 2 from 1 to 2
+move 7 from 7 to 1
+move 1 from 1 to 4
+move 1 from 9 to 8
+move 7 from 2 to 8
+move 1 from 4 to 7
+move 2 from 9 to 4
+move 1 from 4 to 1
+move 1 from 3 to 5
+move 2 from 9 to 8
+move 11 from 8 to 7
+move 2 from 6 to 5
+move 1 from 6 to 9
+move 1 from 1 to 9
+move 1 from 9 to 1
+move 4 from 1 to 4
+move 2 from 1 to 8
+move 1 from 1 to 2
+move 1 from 9 to 5
+move 2 from 4 to 3
+move 2 from 2 to 7
+move 2 from 3 to 9
+move 1 from 9 to 1
+move 1 from 9 to 1
+move 5 from 5 to 1
+move 19 from 5 to 6
+move 5 from 1 to 4
+move 1 from 2 to 9
+move 1 from 1 to 3
+move 7 from 5 to 8
+move 1 from 3 to 6
+move 8 from 7 to 3
+move 7 from 4 to 8
+move 3 from 8 to 5
+move 1 from 4 to 1
+move 1 from 9 to 4
+move 1 from 4 to 9
+move 1 from 5 to 2
+move 2 from 5 to 6
+move 2 from 8 to 2
+move 7 from 8 to 1
+move 1 from 1 to 7
+move 3 from 6 to 9
+move 2 from 3 to 2
+move 1 from 2 to 1
+move 1 from 8 to 7
+move 2 from 9 to 6
+move 2 from 9 to 5
+move 1 from 5 to 6
+move 1 from 2 to 8
+move 2 from 1 to 7
+move 1 from 4 to 3
+move 3 from 2 to 5
+move 7 from 1 to 3
+move 10 from 3 to 4
+move 3 from 5 to 4
+move 1 from 3 to 8
+move 3 from 3 to 2
+move 1 from 8 to 1
+move 1 from 1 to 3
+move 3 from 8 to 3
+move 5 from 4 to 6
+move 1 from 2 to 3
+move 4 from 6 to 4
+move 1 from 5 to 7
+move 4 from 3 to 4
+move 1 from 2 to 8
+move 12 from 7 to 6
+move 1 from 8 to 2
+move 2 from 2 to 7
+move 1 from 8 to 4
+move 23 from 6 to 3
+move 14 from 3 to 6
+move 15 from 4 to 6
+move 1 from 8 to 6
+move 10 from 3 to 7
+move 2 from 4 to 2
+move 11 from 7 to 8
+move 2 from 2 to 6
+move 44 from 6 to 9
+move 21 from 9 to 3
+move 12 from 3 to 6
+move 1 from 7 to 4
+move 1 from 4 to 7
+move 9 from 3 to 2
+move 2 from 8 to 6
+move 3 from 2 to 4
+move 17 from 9 to 1
+move 3 from 4 to 6
+move 2 from 2 to 9
+move 4 from 9 to 2
+move 10 from 6 to 9
+move 1 from 7 to 6
+move 4 from 9 to 5
+move 4 from 2 to 4
+move 14 from 1 to 5
+move 4 from 4 to 3
+move 3 from 2 to 9
+move 9 from 9 to 7
+move 1 from 2 to 5
+move 9 from 8 to 5
+move 8 from 7 to 2
+move 4 from 3 to 8
+move 5 from 6 to 2
+move 3 from 1 to 6
+move 1 from 7 to 1
+move 4 from 2 to 4
+move 3 from 6 to 4
+move 3 from 8 to 3
+move 13 from 5 to 2
+move 2 from 3 to 5
+move 12 from 5 to 9
+move 1 from 3 to 5
+move 1 from 5 to 9
+move 1 from 8 to 3
+move 4 from 9 to 5
+move 6 from 4 to 5
+move 12 from 9 to 7
+move 1 from 9 to 3
+move 1 from 3 to 2
+move 12 from 5 to 6
+move 12 from 7 to 2
+move 1 from 3 to 7
+move 1 from 4 to 8
+move 33 from 2 to 8
+move 1 from 7 to 5
+move 1 from 1 to 2
+move 4 from 5 to 4
+move 3 from 2 to 5
+move 34 from 8 to 6
+move 1 from 4 to 3
+move 1 from 5 to 7
+move 1 from 7 to 5
+move 3 from 4 to 9
+move 2 from 9 to 7
+move 1 from 9 to 4
+move 1 from 3 to 7
+move 1 from 5 to 8
+move 1 from 5 to 1
+move 1 from 5 to 7
+move 1 from 4 to 8
+move 1 from 1 to 4
+move 1 from 4 to 2
+move 3 from 7 to 5
+move 2 from 8 to 5
+move 1 from 2 to 8
+move 4 from 6 to 2
+move 1 from 8 to 6
+move 1 from 7 to 9
+move 29 from 6 to 7
+move 4 from 2 to 3
+move 2 from 5 to 8
+move 1 from 9 to 5
+move 2 from 8 to 1
+move 23 from 7 to 5
+move 2 from 6 to 1
+move 23 from 5 to 6
+move 1 from 3 to 6
+move 4 from 5 to 9
+move 2 from 1 to 3
+move 5 from 3 to 8
+move 2 from 6 to 5
+move 2 from 1 to 4
+move 1 from 9 to 8
+move 1 from 9 to 1
+move 1 from 4 to 6
+move 2 from 5 to 6
+move 6 from 7 to 8
+move 2 from 9 to 2
+move 18 from 6 to 5
+move 21 from 6 to 4
+move 1 from 1 to 6
+move 2 from 6 to 7
+move 2 from 7 to 9
+move 2 from 2 to 8
+move 7 from 4 to 3
+move 12 from 5 to 3
+move 1 from 9 to 5
+move 1 from 9 to 4
+move 6 from 5 to 2
+move 17 from 3 to 4
+move 3 from 4 to 3
+move 1 from 2 to 4
+move 5 from 2 to 8
+move 1 from 5 to 8
+move 19 from 8 to 7
+move 1 from 3 to 6
+move 1 from 8 to 4
+move 1 from 6 to 1
+move 15 from 4 to 6
+move 1 from 1 to 4
+move 3 from 3 to 5
+move 4 from 6 to 7
+move 1 from 4 to 7
+move 10 from 6 to 7
+move 16 from 4 to 5
+move 24 from 7 to 2
+move 8 from 7 to 8
+move 1 from 4 to 2
+move 6 from 8 to 7
+move 1 from 8 to 7
+move 1 from 6 to 9
+move 14 from 5 to 4
+move 9 from 7 to 8
+move 4 from 5 to 1
+move 2 from 1 to 5
+move 3 from 8 to 6
+move 2 from 6 to 9
+move 2 from 2 to 8
+move 6 from 2 to 7
+move 3 from 4 to 6
+move 1 from 3 to 4
+move 3 from 5 to 7
+move 1 from 6 to 9
+move 5 from 7 to 2
+move 4 from 9 to 1
+move 1 from 7 to 9
+move 9 from 8 to 4
+move 5 from 1 to 2
+move 2 from 6 to 1
+move 6 from 4 to 7
+move 1 from 7 to 3
+move 1 from 3 to 9
+move 1 from 9 to 7
+move 1 from 6 to 7
+move 9 from 4 to 5
+move 7 from 7 to 9
+move 3 from 7 to 5
+move 1 from 9 to 2
+move 6 from 9 to 8
+move 4 from 4 to 5
+move 1 from 4 to 2
+move 1 from 4 to 2
+move 2 from 1 to 2
+move 1 from 9 to 8
+move 10 from 2 to 4
+move 8 from 2 to 7
+move 12 from 2 to 9
+move 6 from 7 to 4
+move 1 from 1 to 2
+move 8 from 9 to 8
+move 7 from 5 to 1
+move 9 from 4 to 3
+move 14 from 8 to 4
+move 1 from 8 to 4
+move 1 from 1 to 5
+move 1 from 5 to 2
+move 3 from 2 to 4
+move 1 from 7 to 1
+move 1 from 7 to 3
+move 2 from 1 to 7
+move 3 from 5 to 7
+move 2 from 7 to 6
+move 1 from 6 to 5
+move 3 from 7 to 1
+move 1 from 6 to 8
+move 1 from 8 to 7
+move 1 from 3 to 6
+move 1 from 7 to 1
+move 4 from 1 to 4
+move 6 from 3 to 2
+move 3 from 1 to 2
+move 3 from 3 to 6
+move 3 from 2 to 6
+move 6 from 6 to 5
+move 1 from 1 to 4
+move 1 from 9 to 6
+move 5 from 2 to 1
+move 3 from 1 to 2
+move 2 from 9 to 8
+move 3 from 1 to 5
+move 1 from 9 to 7
+move 25 from 4 to 1
+move 1 from 1 to 7
+move 2 from 8 to 3
+move 13 from 1 to 9
+move 2 from 3 to 5
+move 8 from 5 to 9
+move 4 from 2 to 1
+move 2 from 6 to 7
+move 10 from 5 to 9
+move 4 from 7 to 2
+move 2 from 2 to 3
+move 9 from 9 to 2
+move 4 from 4 to 5
+move 4 from 5 to 4
+move 5 from 1 to 4
+move 10 from 4 to 5
+move 22 from 9 to 1
+move 2 from 2 to 7
+move 3 from 2 to 1
+move 6 from 2 to 6
+move 1 from 7 to 1
+move 10 from 5 to 7
+move 15 from 1 to 4
+move 13 from 1 to 5
+move 3 from 6 to 8
+move 1 from 8 to 9

2022/inputs/06.txt

@@ -0,0 +1 @@
+grvrnvrnnjljbjqjpqjjvhhzwwrbwwbblrltrrpbbbbqnnqbbbbsvbvmbvmbbrsrqrzrllwbbbqzqrqnqrnrjnnjccdggwqqhrrjcjmjmllgrlglhlclmlvlvsshwwsggmfmdfddgdfftrrczrcczhzppgdgrdggghmmdwwqgggslglfgfcgccmjcjwjrwjrjcrjjsgjjvddpwpgpbbgwbgwwhnhfftbffhpfphhfqfrqfrfnfpprvrsrhrfrllfhhrsrhssvfsvsnvsnsswtwtlthllrjjwddtggzczgcchwcwppfbbdvdrdzrdrvrwwsbsfbssqfsfjsjcscttlztllgjjlbbdsdtssvvvwlvlqqnhqqtdqtddjcdcjjpbphhgtgtqtzqqzhqqtgtvtmvtvrvqrvvfmfmppzzbwwnddzttfpfrrlddbppfqppnwnswwdhwdwjjqljqqthtnhnddgmgcmgcmgcmmfmfttrzzfdzztllmjlllgcgbbcqcvccpnndbdjbjmmzbztzptzpprpddptpprhhvlvmlmpmmljjnnjsjfjjvgjjvzzfgfzfbftbftttgstgstgtpggflfcfqqtctltgltldlzdlzzmmlddnvddzfddppmnpptzptpvttwstwswvwrvvbfbjjjbmjjdvdvrvdddrwrhrzrqqhghhrwhwhrrmppsgpsgszzdfdfwwmtwtvwvgvffmqqqtqntqnnjcncbnbwnnzggrdrqqjbqjjwjqqqwlqwlwzlljhhfsfsqsrqqhwqqwbbqbvvlflrrlglbbjhhjmhjjcmcjcgczcfcgcqqczcnnvjnnlddmpmcppgvgjgddvrrnsnmnqmqgmmnppwgwcgwgssbddgtdgdgmdgmgvvmjmvmjmvvsfssdgdghdggbfbqbdbjbsbmmrpmrprggbllwrwpwtppzvppzsssdnsdnnvnhvvvzvfzfqqnnmlnltldtdvdbdblddsmmlccmlmvlmvmmcsctctrtsrstsbsrshsddlmddmppgsscttnrtrqqcvcwwlnlznnnvcnvvtnvnbnmbmvmppjgjdjtddmpdmdvvmgvvdqdlqlhhzccsggjdjsdsttctjctjtfjttppdzpzzbjbwwmwbblslzslzszlzrrcbrrfggvcczjjtbbdnnggbwblwlbwlwqqfvfqfddrrfccvlllhmhhhrthrthrrnbnzbbpzplphprrrnbbghhnshnhbblqqqvwwffnmnmhhtccpqpvqvbvnvvfnfsnffdjdllwffcddgcgrgjrggchcpcddtbbdtdmtdmmhhtphtpppclcpcvcjvcjjfqfzqqphpnhnrnhhpdhhtfhhbbmqmfmsmvssgqqfssqgglnnqmnmbnmbbllrdrgdrdvrdvdsvvnddgtgddcdqdsqdqbqqlhhwdhdgdcgcdchchrchhpvvpgvgrrfggwfwgmpddbhfngtrwswfszgsggnpsntjpslrpjqsffzrlnbnzdtqpqtjzwlhhgrsrbvnccnsjmzcbqgcbtbqlzhnpnhhrrvqwjwzzvrlcrmjhcscrqhpqmfzbnvcwwqhcjjlnggmpbwztzfswmsbjshnsgfmdlzvzczhrdwgwbghszpnbfpctrshbfhspsczcqcrrqcpwwpfzhjqtpqgjbztrpzrlgfdjbmlwdvlvnfmdzbwsbbhlbszvwcpztlchjrqbmsftltmqpfgdpmdgjvwqqtjsqlfqrwmsnlqgsbqfwsdnfvzthmbplvszfcmlptlcjpnfpjsphsmmjplwjqphgvzbtbjtpttqhlwtgnrjvmvsfsztmsqszzlhqqhfslsvhzgtsssfctzgsqbgdzlpwbsmpcnjqshhhcwqdsdzdhnjfqzqnqdlrpddcgrgldgqbjmdtwgppdczzrjvmcfqjbpjzbtjmgdphlbwnsnpfdqlhwvvmpwzsrztnwvtlbphljmjwsgbphgmwhdmfhpvsmvsjccjhfvqtvfmmlnggncltvtrgmbtfqsvfnlvcmjnjwzcrpjnsgntvhjbtdlptshbhhchqmsprhqzdnfpjqccdfvnzjtlbsmmwvzlwlvmsbrnhqctvtvbfhntdctjnrbcrrlmsnwbbjbcbbgrrhfqwzwwfgvsvgbwnttghtgpspzwzfhffsqjvwwttntnvlwftsfvtttgnprzrzsghvjrdtsfdvzswhmrfcdqsgvrlhzbnvbmjlqrftnnbtwqtvlvwznfbslhdqjbntdgpprfqchjvgvzjssdztjlzwfljjmfvzrbbtczggzqwrnqqgzzcbqjcpfqfrbwtdjrrvbszsjdjcpdfjscsvnltcgwvqsgnhbfgnfnddnpmbzbptrmvqzpvbdpfdvtlmgnnjwflgdbfnmvsdnmlvgcpwflwvdbtbfwtfpsmqsplnzwlwgvbjrhghwrnrswsggbqpdjcjrgbgnsqdvwzzwftvjqgjzzcdvpbbjzpphmbcqmrjvgqwfgrsnqvhwflmhgrlvbpwdcsrlqwfrwppqbrdhwqtvczpclpsbsjcptgblbbsqmbhjjgzwvlcnhnzcttmpjsgchmppgphqlzlcsqcgbbjgtjjvmttdztfdptzgvmpnqrcmpmcdlpnbztllvqbggqbqhlqvdwsrwzsjwfrqvcbvsgfdptmrzpvdfblmhlzrvpmsljlqqzrhlnmwncpfhvqlsbtrjbfcrnfvjvddrhdbbczjdsrdvzlbqrccssdzcpmdsqbprjppfzdwfdswptgzcmjqfhcwsqfqhvrslffqfbcvhdzljzrmtwmfdwzdhhjcmbjtvjhzzwfqhrcslztdbnlwmmhbbbgdscjcdzftnchqfnflnsdqjscfrqpnfbftpzvtmrwncqfqqflschpfnjsjlqcjdjgtwpqhgcnjdmnnvmmpwdspmnrgqrptqwcvbtdwpqlbtwpqgwgfrzlrhtvrvzhmhmwhfdsrhpcczqfltsgtgrfwcvlcvtlhqqwnrqgzpnzbfmzbdwqwbsfvbshrgzqdbgvrhzhzlbqsfzttmsnmrqmwgtzbvdqdrbgcpclzjrhdbjtpcdbbznjgtbwbqrnpvffdmwtrbhhstcmnjcwbbnmpbvmjprtzgcptmtrffwhvfgdljnrbbrblbfbgdwtjrtgqgrpvpgjqrjzczvvlspgdbzftqgqvgdqlglbgvgjdcztznszcwfqhmwbrbjcfstzdcmdsssqfhtzpdgmzjscvbdzgbhhgdqgvfwrzmhdrhlsvlzjjzbzdljcbhncppwrtptjgszlqsrqpzqcsgvdvzmgvwgsncnbffttslphcstqvfwbwzbflmshcbnhpljgqwmmwwzlgpbcqnrtqlwcjcrclfdrnnmvtbfdztdfvtqrsgdptfcfpzpsldhzmrngggfvdqggtlfqqwsldprcffsstnnpmsbbvghdbpprqbssnprdbqclzqtgsrczwcvqwrrfmmfwsndvtvqljwwglrgbphdvvwgctbbmtrbpzqtspgrlhmnhjcdwhwvssgspzjbcfjttjqbdpdmptfzzjcfqljpqddfssmffqprvbptfvdshsdmfmdtmlbnmbmjjjsgmlmwmgcwhbrbgchrstptvdlqgddfzddlzhwjmsvvcjwvqtzjtsctfmzchlbrvlgdzbvdlbfpvhptpltrdmcgjghcpwvwqqnrzdtnmgdncplhdpsgpnbprbgshffwwsdhpgqsbmwdtpnhhltlcqfrjtswcchzvlhdgrmjwhgwppdjqlgmdhwbllqvzrchgclmqdlghjsvmwlflmhhmdzbfjhjnvwphnjbclmdpgflqgtfsmsjslntfcmtbphnrgpdcqtjzjttdtgjmvhzsrfnrjqssvwpcslpfstbpfsrsntmftmdgsqrrsnddqfmchrhtlhmqndvvllnvltdzfphjqnvmcdsgfpcmjftgdpntjzplqljhtthvnbzbzwvfnqsjvnfwhmtbsspjslgfjvdgfjpwrsgqwntntjcqtdgnhnsfwhhqfwbwhdrftj

2022/inputs/07.txt

@@ -0,0 +1,983 @@
+$ cd /
+$ ls
+dir gqcclj
+dir lmtpm
+dir nhqwt
+dir qcq
+dir vwqwlqrt
+$ cd gqcclj
+$ ls
+62425 dqp.gjm
+174181 hrtw.qsd
+273712 pflp.mdw
+169404 zlthnlhf.mtn
+180878 zprprf
+$ cd ..
+$ cd lmtpm
+$ ls
+dir clffsvcw
+163587 cvcl.jqh
+dir dcqnblb
+dir dtpwln
+dir fvt
+dir hrcrw
+dir jdqzmqn
+236754 nrdmlj
+205959 pflp.mdw
+dir qcq
+dir rsn
+129926 vdgcqdn.sqd
+dir zprprf
+$ cd clffsvcw
+$ ls
+6997 dcqnblb.wbh
+145711 dqp
+159225 pflp.mdw
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir dcqnblb
+dir gfn
+dir lpswsp
+dir lvt
+dir zprprf
+$ cd dcqnblb
+$ ls
+2020 grpdmd.ggz
+dir zpswzfvg
+$ cd zpswzfvg
+$ ls
+206998 zprprf.gnw
+$ cd ..
+$ cd ..
+$ cd gfn
+$ ls
+277530 rhbvtblc.mvw
+$ cd ..
+$ cd lpswsp
+$ ls
+173180 dcqnblb
+$ cd ..
+$ cd lvt
+$ ls
+dir hjllwsvl
+dir ptbt
+$ cd hjllwsvl
+$ ls
+dir wqnc
+$ cd wqnc
+$ ls
+64695 grpdmd.ggz
+$ cd ..
+$ cd ..
+$ cd ptbt
+$ ls
+150880 vvbt.gtp
+$ cd ..
+$ cd ..
+$ cd zprprf
+$ ls
+dir ldzslndn
+dir qftt
+$ cd ldzslndn
+$ ls
+dir bwqqsbhg
+129454 vbn
+$ cd bwqqsbhg
+$ ls
+108701 zprprf.gss
+$ cd ..
+$ cd ..
+$ cd qftt
+$ ls
+64268 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dtpwln
+$ ls
+196215 cvcl.jqh
+dir dpwg
+dir ldzslndn
+dir znnsqqh
+$ cd dpwg
+$ ls
+192388 gmh
+47754 grgzh.qdl
+99449 hqsh
+dir pbmf
+50061 pflp.mdw
+192902 qcq.pgg
+dir rmpvj
+dir scgc
+$ cd pbmf
+$ ls
+210083 wpfnwbl.mgf
+$ cd ..
+$ cd rmpvj
+$ ls
+125738 nmlnbvrd
+226214 zprprf.jnp
+114257 zprprf.srs
+$ cd ..
+$ cd scgc
+$ ls
+182115 rrc.rcc
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+201992 qcrm.cpd
+$ cd ..
+$ cd znnsqqh
+$ ls
+85635 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd fvt
+$ ls
+dir dcqnblb
+dir gnc
+75864 vfn
+$ cd dcqnblb
+$ ls
+dir dcqnblb
+dir lbnflwsh
+$ cd dcqnblb
+$ ls
+269901 cvcl.jqh
+$ cd ..
+$ cd lbnflwsh
+$ ls
+33336 grpdmd.ggz
+42861 phg.wmc
+$ cd ..
+$ cd ..
+$ cd gnc
+$ ls
+dir jhjbjsp
+dir jjppr
+$ cd jhjbjsp
+$ ls
+96177 ldzslndn
+$ cd ..
+$ cd jjppr
+$ ls
+181016 dqp
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd hrcrw
+$ ls
+261376 dtjfpppr.dww
+54658 vsrgvw.pfn
+$ cd ..
+$ cd jdqzmqn
+$ ls
+52342 dcpndc.vlg
+171946 gggpchh.tbb
+dir ldzslndn
+11156 nbfrfvv.gzw
+$ cd ldzslndn
+$ ls
+107873 cvcl.jqh
+216034 gfdjrbz
+68844 pqllfrrh.jcf
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+152886 ldzslndn.ltn
+105125 vwplh.vbf
+$ cd ..
+$ cd rsn
+$ ls
+15385 hqcmjdgv.jjv
+105735 qcq.bzg
+58805 snczcsp
+26668 vbn
+$ cd ..
+$ cd zprprf
+$ ls
+dir chbmq
+dir dcqnblb
+dir dqp
+dir nfspb
+89506 zprprf.hnt
+$ cd chbmq
+$ ls
+dir cnjvw
+dir dqp
+151434 frsvrdnt
+dir msztjvcb
+240689 qcq.jlh
+dir sjzrcg
+97312 vnr.zfr
+dir zprprf
+$ cd cnjvw
+$ ls
+dir bpbs
+252403 cqhtshc
+dir djmjhn
+10935 fhqmswr
+6582 pdwml.ldd
+dir qcq
+219282 rfmd
+$ cd bpbs
+$ ls
+147582 bnhwsnsj.gdm
+61362 cvcl.jqh
+152857 vdgcqdn.sqd
+$ cd ..
+$ cd djmjhn
+$ ls
+dir bjdbcjbb
+dir dcqnblb
+dir dqp
+dir lgdwtt
+$ cd bjdbcjbb
+$ ls
+110710 cvcl.jqh
+252792 hmshctr.lgz
+dir mjhtmbj
+189745 shsswcgr
+dir tfnhp
+194940 vbn
+dir zprprf
+$ cd mjhtmbj
+$ ls
+dir dqp
+dir hbthpcmb
+$ cd dqp
+$ ls
+200832 sbcrz.qgw
+$ cd ..
+$ cd hbthpcmb
+$ ls
+55191 ffcntg
+$ cd ..
+$ cd ..
+$ cd tfnhp
+$ ls
+276825 dqp
+161538 gqmr.wgb
+$ cd ..
+$ cd zprprf
+$ ls
+287638 dcqnblb.ssp
+41274 hgmrvj.mwf
+249118 sbb.gsf
+105141 wwrg.gqz
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+1957 btmmc
+32386 dtzbzg.dhm
+dir mmrbj
+98283 ntmhfgtl.pmf
+dir zprprf
+$ cd mmrbj
+$ ls
+273194 wnsq
+251527 zprprf
+$ cd ..
+$ cd zprprf
+$ ls
+27678 ldzslndn.rrl
+62866 ljf.fdj
+148502 qcq.dlg
+dir rvgqvm
+179231 tllnmhn.pjp
+64033 vbn
+dir zcdrj
+$ cd rvgqvm
+$ ls
+dir ntbv
+262324 prhgj.szz
+dir qbvdh
+$ cd ntbv
+$ ls
+116608 cgv.fvj
+175200 swpswq.twt
+$ cd ..
+$ cd qbvdh
+$ ls
+160353 sdhfrb.wjn
+$ cd ..
+$ cd ..
+$ cd zcdrj
+$ ls
+283262 ctl
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir jfzm
+111438 rdrgb.mjf
+64194 wgtmqrq
+dir zprprf
+$ cd jfzm
+$ ls
+158774 pflp.mdw
+$ cd ..
+$ cd zprprf
+$ ls
+215264 sgsstcp
+$ cd ..
+$ cd ..
+$ cd lgdwtt
+$ ls
+dir qcq
+$ cd qcq
+$ ls
+165461 ldzslndn.vvb
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+dir dpd
+165044 grpdmd.ggz
+82343 ldzslndn
+dir mwg
+176689 psjcwp.wct
+44404 qcq.zwd
+$ cd dpd
+$ ls
+84087 dqp
+227386 zprprf.gfs
+$ cd ..
+$ cd mwg
+$ ls
+214086 pflp.mdw
+dir sjjsdn
+225859 wcdt
+158892 zprprf.frs
+$ cd sjjsdn
+$ ls
+260121 gplgp.dfn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir hcrwclpg
+dir zphd
+$ cd hcrwclpg
+$ ls
+dir cmqntjj
+16393 ldzslndn.qbm
+91152 qqdtc.zdq
+$ cd cmqntjj
+$ ls
+272266 ldzslndn.pll
+$ cd ..
+$ cd ..
+$ cd zphd
+$ ls
+165711 chftwcsw.fqw
+256871 cvcl.jqh
+251168 zprprf.gfv
+$ cd ..
+$ cd ..
+$ cd msztjvcb
+$ ls
+206231 brzn.lmn
+dir dcqnblb
+21571 dqp
+dir fmn
+45779 mlfctz.cjr
+288827 pflp.mdw
+220578 qcq.fqf
+$ cd dcqnblb
+$ ls
+198121 ghbwgs
+93681 nmqhl.vpq
+$ cd ..
+$ cd fmn
+$ ls
+29407 mdfws.qvs
+$ cd ..
+$ cd ..
+$ cd sjzrcg
+$ ls
+155120 ddclvsjr.rpq
+136029 ldzslndn.dcm
+dir vhzh
+$ cd vhzh
+$ ls
+212446 vbn
+$ cd ..
+$ cd ..
+$ cd zprprf
+$ ls
+240335 crt.gqh
+185363 gnmm.qgh
+dir ldzslndn
+dir nwl
+dir qll
+277043 vbn
+217796 vtvgpdl.vtm
+$ cd ldzslndn
+$ ls
+273570 cvcl.jqh
+68510 fgdmz.hrc
+dir npq
+dir swjrzzrm
+$ cd npq
+$ ls
+97923 dzcjsqwt
+$ cd ..
+$ cd swjrzzrm
+$ ls
+180599 tmpgn.bjf
+$ cd ..
+$ cd ..
+$ cd nwl
+$ ls
+171833 dlwrfhh.qgn
+$ cd ..
+$ cd qll
+$ ls
+219926 dcqnblb.bvn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir lvpb
+276198 tbgcm.qct
+$ cd lvpb
+$ ls
+142590 bvhjlld
+268259 gnjfg.sgb
+dir qcq
+206220 qcq.zsg
+258137 rrsw.dnb
+dir tmr
+215549 vbn
+$ cd qcq
+$ ls
+dir mmpgd
+dir tdsz
+dir tmfvsjwc
+$ cd mmpgd
+$ ls
+70793 jwbnpwnn
+$ cd ..
+$ cd tdsz
+$ ls
+246310 tdvrhhg.bzq
+$ cd ..
+$ cd tmfvsjwc
+$ ls
+103899 grpdmd.ggz
+287850 ldzslndn
+125930 llhr
+$ cd ..
+$ cd ..
+$ cd tmr
+$ ls
+83344 fbtfcg.hqp
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir lbgmcbv
+dir nbg
+$ cd lbgmcbv
+$ ls
+81776 wzdzzdp
+$ cd ..
+$ cd nbg
+$ ls
+dir mfsgjp
+155574 pflp.mdw
+$ cd mfsgjp
+$ ls
+199400 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd nfspb
+$ ls
+262412 csrdtbs
+73867 vbn
+136389 zqps.hjt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd nhqwt
+$ ls
+123766 cvcl.jqh
+dir dhrtvctp
+222086 grpdmd.ggz
+dir gzg
+26005 lhpmz.tgz
+dir mcnjwwfr
+117122 msn.gst
+$ cd dhrtvctp
+$ ls
+224079 vdgcqdn.sqd
+$ cd ..
+$ cd gzg
+$ ls
+124395 dqp
+dir wqdbtqm
+$ cd wqdbtqm
+$ ls
+237354 pflp.mdw
+212019 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd mcnjwwfr
+$ ls
+92504 cshdztf
+dir dctl
+dir dqp
+dir flcrmhlj
+161879 grpdmd.ggz
+dir gtt
+dir hlbnhchz
+220093 mdtdsgvm.zgg
+dir twntr
+287192 vbn
+$ cd dctl
+$ ls
+dir bbhch
+155396 hrrj.jzm
+164971 pblqmwj.vdb
+dir wnlgfpvf
+$ cd bbhch
+$ ls
+dir dpqtp
+dir jvdrcw
+$ cd dpqtp
+$ ls
+174135 gwb.qrb
+$ cd ..
+$ cd jvdrcw
+$ ls
+215993 dcqnblb.cqp
+200800 stjttf.ngc
+$ cd ..
+$ cd ..
+$ cd wnlgfpvf
+$ ls
+135978 cvcl.jqh
+dir dqp
+54018 lbrfmt
+$ cd dqp
+$ ls
+270516 dcqnblb.jqw
+dir dqp
+144626 grpdmd.ggz
+157731 hvcv.rhp
+133773 lnnt
+76250 vdgcqdn.sqd
+$ cd dqp
+$ ls
+41504 zprprf.cmc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir dqp
+dir ldzslndn
+236737 mqzcvm.fjh
+239746 nhcdz.ncj
+dir rpchqq
+248824 vdgcqdn.sqd
+250937 zrchht.mwg
+$ cd dqp
+$ ls
+203381 qcq.djm
+$ cd ..
+$ cd ldzslndn
+$ ls
+dir dqp
+dir fptnzlv
+dir gmbnpm
+dir vhvblt
+$ cd dqp
+$ ls
+19579 qcq.lhg
+$ cd ..
+$ cd fptnzlv
+$ ls
+209930 dcqnblb
+$ cd ..
+$ cd gmbnpm
+$ ls
+dir ldzslndn
+dir qcq
+$ cd ldzslndn
+$ ls
+11075 pflp.mdw
+$ cd ..
+$ cd qcq
+$ ls
+dir tdp
+$ cd tdp
+$ ls
+40741 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd vhvblt
+$ ls
+dir lzr
+$ cd lzr
+$ ls
+62245 gbnj.llg
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd rpchqq
+$ ls
+dir bcs
+dir dcqnblb
+dir fvjzn
+dir lrphzrv
+$ cd bcs
+$ ls
+179794 bbn.dzb
+242069 cmjdmzjf.zgf
+1703 cvcl.jqh
+dir gnmhwj
+dir ldzslndn
+152520 qltpsz.jsj
+dir sqqjfps
+$ cd gnmhwj
+$ ls
+dir gvs
+201600 hptn.ftf
+dir hzrnb
+dir qcq
+dir sqhl
+$ cd gvs
+$ ls
+152358 zprprf.mlh
+$ cd ..
+$ cd hzrnb
+$ ls
+94290 gplsfd
+$ cd ..
+$ cd qcq
+$ ls
+91909 vmqd.bmg
+$ cd ..
+$ cd sqhl
+$ ls
+238673 vdgcqdn.sqd
+262885 zmdvr.nfg
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+240461 mdz
+84303 qtj
+$ cd ..
+$ cd sqqjfps
+$ ls
+88753 fwn.tff
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir dqp
+189996 dqp.pvp
+$ cd dqp
+$ ls
+dir qvfjz
+196506 vbn
+$ cd qvfjz
+$ ls
+209316 pflp.mdw
+107459 rwpbh.vpt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fvjzn
+$ ls
+241464 cvcl.jqh
+dir dqp
+dir ldzslndn
+dir msp
+125 pflp.mdw
+131895 vbn
+$ cd dqp
+$ ls
+34019 pflp.mdw
+202957 vbn
+$ cd ..
+$ cd ldzslndn
+$ ls
+147492 cvcl.jqh
+248719 spc.rfv
+$ cd ..
+$ cd msp
+$ ls
+184407 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd lrphzrv
+$ ls
+dir bbwqmbg
+81858 cvcl.jqh
+dir dqp
+248670 gqqsww.tsn
+199141 grpdmd.ggz
+dir ldzslndn
+34514 ldzslndn.ctw
+dir tln
+214615 zprprf.fwm
+$ cd bbwqmbg
+$ ls
+129750 flf
+dir pvlw
+dir qcq
+126 sqcqphz.tbm
+$ cd pvlw
+$ ls
+198005 jfvj.hdv
+$ cd ..
+$ cd qcq
+$ ls
+dir wgdzws
+$ cd wgdzws
+$ ls
+253522 ldzslndn.qwt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+281993 cvcl.jqh
+dir hwqjlwcb
+50532 msccz.qgm
+102187 trv.tnq
+111 wplnmj.bfl
+$ cd hwqjlwcb
+$ ls
+267580 dhjqb.dsb
+153195 ldzslndn.jqv
+41526 mvwcwc.zsc
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+58666 cvcl.jqh
+79950 dqp.tmc
+242217 hns.lrb
+dir njswzh
+240692 vdgcqdn.sqd
+dir zvmjvcdm
+52909 zzh
+$ cd njswzh
+$ ls
+149732 cvcl.jqh
+dir rnmfd
+$ cd rnmfd
+$ ls
+75368 dqp.hmv
+14350 vbn
+$ cd ..
+$ cd ..
+$ cd zvmjvcdm
+$ ls
+dir jgczt
+$ cd jgczt
+$ ls
+dir qcq
+95941 qzvvwshv.jwc
+$ cd qcq
+$ ls
+273942 pflp.mdw
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd tln
+$ ls
+dir bmcng
+1518 lrg
+dir vnjfrhp
+$ cd bmcng
+$ ls
+38917 fqcrt
+$ cd ..
+$ cd vnjfrhp
+$ ls
+dir dcqnblb
+dir dqp
+247186 grpdmd.ggz
+dir ldzslndn
+169216 pflp.mdw
+206487 vdgcqdn.sqd
+16976 vlsrzjmb.mmc
+257938 wjl
+$ cd dcqnblb
+$ ls
+dir dqp
+$ cd dqp
+$ ls
+184133 qcq
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir dcqnblb
+31612 dqp.pnt
+212283 ldzslndn
+61600 vdbfc.ddj
+197189 wpv.wff
+$ cd dcqnblb
+$ ls
+62412 tfzllmrj
+dir zprprf
+$ cd zprprf
+$ ls
+dir bqnpsl
+dir dszrvpzc
+$ cd bqnpsl
+$ ls
+261548 spbsbbsw.cmn
+$ cd ..
+$ cd dszrvpzc
+$ ls
+188232 sggpqslr.smn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+dir bgnhd
+dir pgvcdzwz
+dir qgzhm
+$ cd bgnhd
+$ ls
+56989 cvcl.jqh
+$ cd ..
+$ cd pgvcdzwz
+$ ls
+110034 qhgnndv
+$ cd ..
+$ cd qgzhm
+$ ls
+247232 grpdmd.ggz
+269292 ldzslndn
+153843 tpz
+dir vnschqwr
+162392 wnq.btb
+$ cd vnschqwr
+$ ls
+43005 fvtvzfqm.jvc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd flcrmhlj
+$ ls
+245668 dcqnblb.sdj
+dir lffj
+229909 pflp.mdw
+280176 vbn
+$ cd lffj
+$ ls
+116451 jmzz.jdd
+dir pjlwb
+162815 pmhlqq.snr
+226183 zffth
+$ cd pjlwb
+$ ls
+67518 qcq.hjq
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd gtt
+$ ls
+52105 grpdmd.ggz
+126869 zprprf.fgj
+$ cd ..
+$ cd hlbnhchz
+$ ls
+3064 dqp.lrw
+278756 grpdmd.ggz
+177208 ldzslndn.wlv
+141685 vbn
+$ cd ..
+$ cd twntr
+$ ls
+63747 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+226858 cwblp.zgp
+dir jjqsmfhr
+dir rjbqtrq
+dir vwmpnbts
+141715 wdbhdch
+286381 zprprf
+$ cd jjqsmfhr
+$ ls
+dir btmm
+dir fqndtlgq
+$ cd btmm
+$ ls
+4031 dqp.lrr
+dir fzdd
+$ cd fzdd
+$ ls
+dir vnwpn
+$ cd vnwpn
+$ ls
+dir bzlgsl
+dir ztvzrrbv
+$ cd bzlgsl
+$ ls
+9294 ldzslndn.sqr
+$ cd ..
+$ cd ztvzrrbv
+$ ls
+256017 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fqndtlgq
+$ ls
+271528 ccbmgp.bwd
+$ cd ..
+$ cd ..
+$ cd rjbqtrq
+$ ls
+122150 ldzslndn
+46467 tpdvp.pjf
+$ cd ..
+$ cd vwmpnbts
+$ ls
+47518 fcrwfzvm
+263343 gmc.lrt
+212764 qcq
+$ cd ..
+$ cd ..
+$ cd vwqwlqrt
+$ ls
+dir psrs
+$ cd psrs
+$ ls
+281998 zprprf.hml

2022/inputs/08.txt

@@ -0,0 +1,99 @@
+133120320210233440424211425033311533112110111336536142004454550513525522325223123404213204010312200
+201131111014211324423255354022022243226445013613610423653614522135534505055120330313403031333103010
+312033232323231244025301315245341424106564334260061464515142114141551050411122254121204214442432210
+101223224313414001513045124413405604251532415616200623342234245060512030200002055453441222043022132
+302000022010423415300513533001221654231646352603366222420353100303160621313144421120541324031322221
+022041343104313414435021243154525050055065506466215004364316065443031303052541012204020300331224312
+103341401201343234101335152026143021665443260024145323023321363412215203352344024010350241320230403
+113420142141151035404302242616255522460104100534576523546245441245051223305614204355454223220120301
+141313120334140413444311032422155464031057323373712672513175353623531154646460010504312302300002224
+222122233241135333145102102244620325637577115357373355166254434732406430504542404102101335430322111
+303334221050505214133200215501142243567431213624743475716112467711442460620524310041114411011423020
+314200333004550151023253063621162447552734266222424315622125733562141045411643325165010440012411104
+002041023423222500521530364652321342767176666734452465675417573276212213343035032650010252311440041
+424112310115314154624123026322722176144615437667237551164455332134452657635041110204303331153310423
+403331525242111322464321027125164326531546671615634451453753666614652523355664316050035035431040223
+043240150545010061116502263626227235517673287377662722735257631252161774623714640414211242003124031
+120153432445266666010553121747235535567222344854553227754373283562766712275433030145041514430322020
+130205252451225625553367153422361135376345652238658565468884466665635712475577163231554521534443142
+111112125502543266131422234726554665525278247588365447865236325776254766323137341434403365242323513
+303144132003506154604725457356146262354554756268227328243768455722852644644163423635454133132303535
+355321430425362320027571672735837582654822875282477453446323242873743335342262324741355251635040132
+134315335666154514547724226424352647855667536237263286847676436882327536177762242121655513144251300
+540433012152253201644772517187257277883368828477658659796427367852347254442546347411045431414354124
+123440236041532033152645165666552487887293658447738333978367787858534683322123676621510536503333401
+513523462114216537146475772264724378429935336847846348444575554346687726237537112655265045664650022
+152254463440132245722174776775434287876777476649865634494799993998688326736773121545343121065304241
+250224151321236513227671833576566739347663376834388478944395578563955424353347453672417622666244155
+515223301360505722213752783545553644495694566664938776366634393433784855746658113613537562051065554
+554241245610333147211334537367835857366454575934899676895788946595666473766285253431355325406031452
+100314521636253352672223432738853968767459797559486648888395749643933624738538781345525612342532041
+341462234622615555235573736647638675877393747847457878744844899855446378852378466172227414636330202
+345125124225634624432677378235488673587578945954767695474694483979633396738646725252521775306550112
+413420352557414334236458423883348897736674897485778466695756868398399557654674634472471146623221025
+251143521254271126368347667353953675589776644454498798849645686658369675764886773874127564444411365
+221413142252611772737673846553885549867478965666795885777985495763559573589863845361134756354652555
+243065641366675316826485533843887969469458797465896675796454946875597936434758642384462157714462066
+520553502161266638252882759578566955579648578498775589886979787578896857766344736358531725733564135
+424035430516117723442423478595343855468789497988556567558494878666699996375768427758374271236421335
+252313015177661777278432468494855844559656687766987679695575558744879656544795683583262246546564621
+066230444571526644743382974447835556985988567697575656976987588986595376466888728567376162756500435
+466346066733165454546438886894789699679455689766757985688888664759568963398874674733715475614334101
+325014552177542688745486585579599747867559596676796865787567755944786444539663262282351475561402534
+241163303516225237353826934978454869995779765759887659668665685578986859343646684568651136735352562
+450361264326612736655359595445797648876877955597997887987765775498545883744548752574473726565411112
+554605215356217343577344399893857478777797855566878769757669857854854856357865565536552164136515351
+526446641376374684266375494495458695869978975788699978669887967564769488567376982882762633361324360
+131314671231526545866684867949989786895865986986978678997899677764988874736369482822342624761635224
+623254034413371684428636874768586849979569867987768799666579796798469744978968758623884477174221325
+451620621666445477562568544366499474968796999686779676678989576768596484478933764745243527321126622
+454130052341168772645439448775675586969558878998779766779998798589986885955369648636673756137543515
+052463667567627485865289577459895546659595768687867979887989666587865576357344373227477771625616331
+460630633631764266522893997758984967975685969969798677679989558694657986684466928784764257141450213
+624130637644652532575536775488944945689777797679988979876565896659695947897698966634635115577122034
+312106635521463635433584476586795448766769568869779667989675669974989668369378542526764316562641343
+162151455625714643563689555468449898859656786796979798687579985864586658783373657585741615177725655
+522113305657225658843435489885646557577988797667968888669868768989959977879557377455733555272325032
+304510566333111422674633384687874565587979787768979689685867565897484896499888736286384551117254613
+501463041455354857783745556844585568845776985978966685877875599798784456633539465754543114144204310
+033044042511137887672349889484876755578886688778959586777755687684946795536886522746575472552603266
+506221035322726455557224463853355996897775558969955685797667999588974556935495475632746634441041151
+433136161743725565262636565676447685475989796568778598958657768879849778786859753335661722543205305
+265454361556653132263478888989675487694888975877759959776785674478666588788563747772733262666414514
+052441631644734262283652379957577654769979687765967795697668686969788694345962866843241632716655446
+236003436545632166356247457495793686988694668988898785686844466844799668333966735544674562633412352
+521460600027621624875854349394389587767654998655578976768847769685597639387383648267451531624063352
+342222114334344716267243334967869638699594976567878976765649455495834476654882454551336614731204621
+033566313156263553885434364795389663465876465857797479766958478858465479967473865454116236530266023
+312652012603144155543338267594667756579949844587785799854455597889659839838335338227724422251205254
+300006533237512225736566526838475448787546947968579975977675656694697397732838257677271224106345603
+133143326544516157647526755363599347754745759889457964588954897669586537634253625642342472416641244
+154255220262671713413357272553997888597745494647794956965689397737688378433337485552276212554465555
+100240040401314462336283253854484757937369955476776566463546476496874852334852883176722554655020500
+114224164252562264455188387248845988369836588899857935337746669656565572827235667727764740332042104
+210035410165643165676172383567428973379998596753776399638478657839665546428878531777515004325230423
+210124643010215635561443542385838474565467799589387569934754637575772733563765332372676641151131504
+302221012422133674231332744234367852633548864367379437949776375866557752335873376756770315423300102
+332125266633066263556242566636554222886478446383395355568773939525563625678526672212234343222625410
+025325451166410144267526457225543863563576656495967865696633785745578788783545643421165350000423343
+002055431510265615765734547166486528454663847694453963495886284323368575223225414276066312104153401
+355245141260142612771253626632378444477523462347872628387736452238277834561572523626005254261254042
+203545210065351052363237141625823577635472367448676276452678742864237273162112414622640501555430121
+335510044411666505051763342712375473385677658477545568853568734655885763312211631300144242225254322
+420503535251235101224431771412136627846753333256668624663675776462422374227471570160056336045543305
+311442220344522144201454355125161416822475756464544562823568565277363143626236634605524051151344323
+221042430004563020306242752654674353744234455564453257548654537765566764222366445225313642034222311
+410315020300414623613025143245525766347157877736466252545465214236744364172443246502214503112203230
+342304354225251006345461616171626576425171512572743837515273314522745717111151266035240243530314400
+101402542354002125435251304674647534521162334775342133371111747561164265140621412560624450505304430
+011211315525203435452400223603127166746242764515517634515312173434163762164444142306041434112503201
+312201041521122523410120106532007714457744313215145447526753371116262403622123305243410143403304001
+420143230433241404304622552610552657576751252637557577175144676122663421114064036341501055504120312
+321114124142324224151525015553652243236362311234247651266113535462142056365353412114023231401141232
+144010233331150422332523034411415500511027722375253755262514425243333354512150011301540445044301243
+321223141143321313415515024451144622413543514327723454716501265226013550620005111202312303242203422
+220312222242043544521300416060642531526303363025212311016020154415132623214322110011054242222314401
+120043213410140522500232142235034335033562221102412305131143065020436150033340525535242031300403012
+333011210021031104353104420453564321600565055235040060414452305642301521213234000231332120021102311
+213000422032423433105500120521112552552162045443040565055142555024614151234210022135411312102303010
+311113213314300134505043355233124354500023350433035532626242646113034040102425400244311432332422101

2022/src/common.rs

@@ -0,0 +1,118 @@
+//! Common helper utilities to all days
+
+use anyhow::Result;
+use nom::combinator::map;
+use nom::error::ErrorKind;
+use nom::error::ParseError;
+use nom::Finish;
+use nom::IResult;
+use nom::InputLength;
+use nom::Parser;
+
+/// Parse input from some nom parser and return as an anyhow result
+///
+/// This method exists as a convenience because nom's errors cannot otherwise be easily converted to
+/// an anyhow error, and I don't want to keep track of custom error implementations here.
+pub fn parse_input<'a, O>(
+    input: &'a [u8],
+    mut parser: impl Parser<&'a [u8], O, nom::error::Error<&'a [u8]>>,
+) -> Result<O> {
+    let (unparsed, output) = parser.parse(input).finish().map_err(|e| {
+        anyhow::anyhow!(
+            "Parser error {:?} to parse at {}",
+            e.code,
+            String::from_utf8_lossy(e.input)
+        )
+    })?;
+
+    if !unparsed.is_empty() {
+        Err(anyhow::anyhow!(
+            "Not all input consumed: {}",
+            String::from_utf8_lossy(unparsed)
+        ))
+    } else {
+        Ok(output)
+    }
+}
+
+/// Applies a parser iteratively and reduces the results using the given function. Fails if the
+/// embedded parser doesn't return at least one result.
+///
+/// # Arguments
+/// - `f`: the function to apply
+/// - `g`: the function that combines the result o `f` with previous results
+///
+/// This implementation is based on [`nom::multi::fold_many1`] with minor differences. If
+/// successful, this should probably be upstreamed.
+pub fn reduce_many1<I, O, E, F>(
+    mut f: F,
+    mut g: impl FnMut(O, O) -> O,
+) -> impl FnMut(I) -> IResult<I, O, E>
+where
+    I: Clone + InputLength,
+    E: ParseError<I>,
+    F: Parser<I, O, E>,
+{
+    // Cannot delegate to fold_many0 because that would make the function FnOnce rather than FnMut,
+    // since it would transfer ownership of the embedded parser to fold_many0.
+    move |i: I| {
+        let _i = i.clone();
+        match f.parse(_i) {
+            Err(nom::Err::Error(_)) => {
+                Err(nom::Err::Error(E::from_error_kind(i, ErrorKind::Many1)))
+            }
+            Err(e) => Err(e),
+            Ok((i1, mut acc)) => {
+                let mut input = i1;
+
+                loop {
+                    let _input = input.clone();
+                    let len = input.input_len();
+                    match f.parse(_input) {
+                        Err(nom::Err::Error(_)) => {
+                            break;
+                        }
+                        Err(e) => return Err(e),
+                        Ok((i, o)) => {
+                            // infinite loop check: the parser must always consume
+                            if i.input_len() == len {
+                                return Err(nom::Err::Failure(E::from_error_kind(
+                                    i,
+                                    ErrorKind::Many1,
+                                )));
+                            }
+
+                            acc = g(acc, o);
+                            input = i;
+                        }
+                    }
+                }
+
+                Ok((input, acc))
+            }
+        }
+    }
+}
+
+/// Add an index to repeated successful invocations of the embedded parser.
+pub fn enumerate<I, O, E>(f: impl Parser<I, O, E>) -> impl FnMut(I) -> IResult<I, (usize, O), E> {
+    let mut index = 0usize;
+
+    map(f, move |v| {
+        let res = (index, v);
+        index += 1;
+        res
+    })
+}
+
+/// Return the minimum and maximum of two unordered variables
+pub fn minmax<T>(a: T, b: T) -> (T, T)
+where
+    T: PartialOrd,
+{
+    if a < b {
+        (a, b)
+    } else {
+        (b, a)
+    }
+}

2022/src/day01.rs

@@ -0,0 +1,50 @@
+use std::ops::Add;
+
+use anyhow::Result;
+use nom::character::complete::newline;
+use nom::multi::separated_list0;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::parse_input;
+use crate::common::reduce_many1;
+
+fn parse_elf(input: &[u8]) -> IResult<&[u8], i32> {
+    reduce_many1(terminated(nom::character::complete::i32, newline), Add::add)(input)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let elves = parse_input(input, parse_elf_list)?;
+    Ok(elves.into_iter().fold(0, Ord::max).to_string())
+}
+
+fn parse_elf_list(input: &[u8]) -> IResult<&[u8], Vec<i32>> {
+    separated_list0(newline, parse_elf)(input)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let mut elves = parse_input(input, parse_elf_list)?;
+
+    let (first, third, _) = elves.select_nth_unstable_by(2, |a, b| Ord::cmp(b, a));
+
+    let result = first[1] + first[0] + *third;
+
+    Ok(result.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/01.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "24000");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "45000");
+    }
+}

2022/src/day02.rs

@@ -0,0 +1,125 @@
+use anyhow::Result;
+use nom::character::complete::newline;
+use nom::combinator::map_res;
+use nom::multi::many0;
+use nom::sequence::separated_pair;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::parse_input;
+
+#[derive(Copy, Clone, Eq, PartialEq)]
+enum Rps {
+    Rock,
+    Paper,
+    Scissors,
+}
+
+impl Rps {
+    /// Score we get by playing this move
+    fn score(self) -> u32 {
+        match self {
+            Rps::Rock => 1,
+            Rps::Paper => 2,
+            Rps::Scissors => 3,
+        }
+    }
+
+    /// Score we get from the result from playing given other
+    fn score_against(self, other: Self) -> u32 {
+        match (self, other) {
+            (a, b) if a == b => 3,
+            (Rps::Rock, Rps::Paper) | (Rps::Paper, Rps::Scissors) | (Rps::Scissors, Rps::Rock) => 0,
+            _ => 6,
+        }
+    }
+
+    /// Score if the result is according to the instruction
+    fn score_result(self) -> u32 {
+        match self {
+            Rps::Rock => 0,     // Rock is lose
+            Rps::Paper => 3,    // Paper is draw
+            Rps::Scissors => 6, // Scissors is win
+        }
+    }
+
+    /// Move we need to achieve the result indicated by self
+    fn needed(self, other: Self) -> Self {
+        match (self, other) {
+            (Rps::Paper, other) => other,
+            (Rps::Rock, Rps::Rock) => Rps::Scissors,
+            (Rps::Rock, Rps::Paper) => Rps::Rock,
+            (Rps::Rock, Rps::Scissors) => Rps::Paper,
+            (Rps::Scissors, Rps::Rock) => Rps::Paper,
+            (Rps::Scissors, Rps::Paper) => Rps::Scissors,
+            (Rps::Scissors, Rps::Scissors) => Rps::Rock,
+        }
+    }
+}
+
+impl TryFrom<u8> for Rps {
+    type Error = anyhow::Error;
+
+    fn try_from(value: u8) -> Result<Self, Self::Error> {
+        match value {
+            b'A' | b'X' => Ok(Rps::Rock),
+            b'B' | b'Y' => Ok(Rps::Paper),
+            b'C' | b'Z' => Ok(Rps::Scissors),
+            _ => Err(anyhow::anyhow!("Invalid RPS: {value}")),
+        }
+    }
+}
+
+fn parse_plan(input: &[u8]) -> IResult<&[u8], Vec<(Rps, Rps)>> {
+    fn parse_rps(input: &[u8]) -> IResult<&[u8], Rps> {
+        // Note: alpha1 also sort of works but is significantly slower
+        map_res(nom::bytes::complete::take(1usize), |v: &[u8]| {
+            Rps::try_from(v[0])
+        })(input)
+    }
+
+    fn parse_line(input: &[u8]) -> IResult<&[u8], (Rps, Rps)> {
+        separated_pair(parse_rps, nom::character::complete::char(' '), parse_rps)(input)
+    }
+
+    many0(terminated(parse_line, newline))(input)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let plan = parse_input(input, parse_plan)?;
+
+    let result: u32 = plan
+        .into_iter()
+        .map(|(them, us)| us.score() + us.score_against(them))
+        .sum();
+
+    Ok(result.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let plan = parse_input(input, parse_plan)?;
+
+    let result: u32 = plan
+        .into_iter()
+        .map(|(them, us)| us.score_result() + us.needed(them).score())
+        .sum();
+
+    Ok(result.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/02.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "15")
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "12")
+    }
+}

2022/src/day03.rs

@@ -0,0 +1,79 @@
+use anyhow::Result;
+use itertools::Itertools;
+
+fn priority(item: u8) -> u32 {
+    match item {
+        b'a'..=b'z' => item - b'a' + 1,
+        b'A'..=b'Z' => item - b'A' + 27,
+        _ => 0,
+    }
+    .into()
+}
+
+fn seen(backpack: &[u8]) -> u64 {
+    let mut seen = 0;
+
+    for &b in backpack {
+        seen |= 1 << priority(b);
+    }
+
+    seen
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let mut total = 0;
+
+    for line in input.split(|&b| b == b'\n') {
+        let (first, last) = line.split_at(line.len() / 2);
+
+        let seen = seen(first);
+
+        for &b in last {
+            let prio = priority(b);
+
+            if (seen & (1 << prio)) != 0 {
+                total += prio;
+                break;
+            }
+        }
+    }
+
+    Ok(total.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let mut total = 0;
+
+    for chunk in &input.split(|&b| b == b'\n').chunks(3) {
+        let mut mask = u64::MAX;
+
+        for backpack in chunk {
+            let seen = seen(backpack);
+            mask &= seen;
+        }
+
+        if mask != 0 {
+            debug_assert_eq!(1, mask.count_ones());
+            total += mask.trailing_zeros();
+        }
+    }
+
+    Ok(total.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/03.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "157")
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "70")
+    }
+}

2022/src/day04.rs

@@ -0,0 +1,86 @@
+use anyhow::Result;
+use nom::bytes::complete::tag;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::many0;
+use nom::sequence::separated_pair;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::minmax;
+use crate::common::parse_input;
+
+#[derive(Copy, Clone, PartialOrd, PartialEq)]
+struct Assignment(u32, u32);
+
+impl Assignment {
+    fn one_contains(self, other: Self) -> bool {
+        let (first, second) = minmax(self, other);
+
+        if second.0 == first.0 {
+            first.1 <= second.1
+        } else {
+            second.0 <= first.1 && second.1 <= first.1
+        }
+    }
+
+    fn one_overlaps(self, other: Self) -> bool {
+        let (first, second) = minmax(self, other);
+
+        if second.0 == first.0 {
+            first.1 <= second.1
+        } else {
+            second.0 <= first.1
+        }
+    }
+}
+
+fn parse_assignments(input: &[u8]) -> IResult<&[u8], Vec<(Assignment, Assignment)>> {
+    use nom::character::complete::u32;
+
+    fn parse_single(input: &[u8]) -> IResult<&[u8], Assignment> {
+        map(separated_pair(u32, tag("-"), u32), |(start, end)| {
+            Assignment(start, end)
+        })(input)
+    }
+
+    let parse_line = separated_pair(parse_single, tag(","), parse_single);
+
+    many0(terminated(parse_line, newline))(input)
+}
+
+fn parts_common(input: &[u8], filter: impl Fn(Assignment, Assignment) -> bool) -> Result<String> {
+    let assigments = parse_input(input, parse_assignments)?;
+
+    let overlapping = assigments
+        .into_iter()
+        .filter(|&(a, b)| filter(a, b))
+        .count();
+
+    Ok(overlapping.to_string())
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    parts_common(input, Assignment::one_contains)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    parts_common(input, Assignment::one_overlaps)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/04.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "2")
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "4")
+    }
+}

2022/src/day05.rs

@@ -0,0 +1,166 @@
+use std::cmp::Ordering;
+
+use anyhow::Result;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take;
+use nom::bytes::complete::take_until;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::combinator::opt;
+use nom::multi::fold_many1;
+use nom::multi::many1;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::enumerate;
+use crate::common::parse_input;
+
+type Move = (usize, usize, usize);
+type OwnedStacks = Vec<Vec<u8>>;
+
+fn parse_row<'a>(input: &'a [u8], stacks: &mut OwnedStacks) -> IResult<&'a [u8], ()> {
+    // Forgive me for this crime
+    fold_many1(
+        enumerate(terminated(
+            alt((
+                // Parse a delimited value into a Some(content)
+                map(delimited(tag("["), take(1usize), tag("]")), |v: &[u8]| {
+                    Some(v[0])
+                }),
+                // Or an empty stack into a None
+                map(tag("   "), |_| None),
+            )),
+            opt(tag(" ")),
+        )),
+        || (),
+        move |_, (index, c)| {
+            if let Some(b) = c {
+                if stacks.len() <= index {
+                    stacks.resize_with(index + 1, Vec::new);
+                }
+
+                stacks[index].push(b)
+            }
+        },
+    )(input)
+}
+
+fn parse_stacks(input: &[u8]) -> IResult<&[u8], OwnedStacks> {
+    let mut stacks = Vec::new();
+
+    let (input, _) = terminated(
+        fold_many1(
+            terminated(|input| parse_row(input, &mut stacks), newline),
+            || (),
+            |_, _| (),
+        ),
+        // Skip the line with the numbers
+        take_until("\n\n"),
+    )(input)?;
+
+    // Reverse the stacks since we parsed them top-down
+    for stack in &mut stacks {
+        stack.reverse();
+    }
+
+    Ok((input, stacks))
+}
+
+fn parse_task(input: &[u8]) -> IResult<&[u8], (OwnedStacks, Vec<Move>)> {
+    fn parse_usize(input: &[u8]) -> IResult<&[u8], usize> {
+        map(nom::character::complete::u32, |v| v as usize)(input)
+    }
+    let (input, stacks) = parse_stacks(input)?;
+
+    // Consume the double newline
+    let (input, _) = tag("\n\n")(input)?;
+
+    let (input, moves) = many1(terminated(
+        tuple((
+            preceded(tag("move "), parse_usize),
+            preceded(tag(" from "), parse_usize),
+            preceded(tag(" to "), parse_usize),
+        )),
+        newline,
+    ))(input)?;
+
+    Ok((input, (stacks, moves)))
+}
+
+/// Some magic to get two mutable references into the same slice
+fn get_both(stacks: &mut [Vec<u8>], from: usize, to: usize) -> (&mut Vec<u8>, &mut Vec<u8>) {
+    match from.cmp(&to) {
+        Ordering::Greater => {
+            let (begin, end) = stacks.split_at_mut(from);
+            (&mut end[0], &mut begin[to])
+        }
+        Ordering::Less => {
+            let (begin, end) = stacks.split_at_mut(to);
+            (&mut begin[from], &mut end[0])
+        }
+        Ordering::Equal => panic!("Tried to stack from and to {from}"),
+    }
+}
+
+fn compute_answer(stacks: &mut [Vec<u8>]) -> Result<String> {
+    let mut result = String::with_capacity(stacks.len());
+
+    for stack in stacks {
+        result.push(
+            *stack
+                .last()
+                .ok_or_else(|| anyhow::anyhow!("Encountered empty stack"))? as char,
+        );
+    }
+
+    Ok(result)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let (mut stacks, moves) = parse_input(input, parse_task)?;
+
+    for (count, from, to) in moves {
+        let (from, to) = get_both(&mut stacks, from - 1, to - 1);
+
+        let drain_start = from.len() - count;
+
+        to.extend(from.drain(drain_start..).rev());
+    }
+
+    compute_answer(&mut stacks)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let (mut stacks, moves) = parse_input(input, parse_task)?;
+
+    for (count, from, to) in moves {
+        let (from, to) = get_both(&mut stacks, from - 1, to - 1);
+
+        let drain_start = from.len() - count;
+
+        to.extend(from.drain(drain_start..));
+    }
+
+    compute_answer(&mut stacks)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/05.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "CMZ");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "MCD");
+    }
+}

2022/src/day06.rs

@@ -0,0 +1,68 @@
+use anyhow::Result;
+
+fn find_first(input: &[u8], unique: usize) -> Result<usize> {
+    let mut seen = [false; 256];
+
+    let mut tail_it = input.iter();
+
+    let mut first = 0;
+
+    // Loop invariant: input[first..last] contains only unique characters
+    for (last, &c) in input.iter().enumerate() {
+        if seen[c as usize] {
+            first += (&mut tail_it)
+                .take_while(|&&b| b != c)
+                .map(|&b| seen[b as usize] = false)
+                .count()
+                + 1; // +1 because take_while doesn't return the first element that didn't satisfy the condition, while we do need to count it
+        } else {
+            // New unique character found: input[first..=last] contains unique characters
+            if last - first + 1 == unique {
+                return Ok(last + 1);
+            }
+
+            seen[c as usize] = true;
+        }
+    }
+
+    anyhow::bail!("Did not find unique sequence of length {unique}");
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    Ok(find_first(input, 4)?.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    Ok(find_first(input, 14)?.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLES: &[&[u8]] = &[
+        b"mjqjpqmgbljsphdztnvjfqwrcgsmlb",
+        b"bvwbjplbgvbhsrlpgdmjqwftvncz",
+        b"nppdvjthqldpwncqszvftbrmjlhg",
+        b"nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg",
+        b"zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw",
+    ];
+
+    #[test]
+    fn sample_part1() {
+        const CORRECT: &[usize] = &[7, 5, 6, 10, 11];
+
+        for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
+            assert_eq!(find_first(sample, 4).unwrap(), correct);
+        }
+    }
+
+    #[test]
+    fn sample_part2() {
+        const CORRECT: &[usize] = &[19, 23, 23, 29, 26];
+
+        for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
+            assert_eq!(find_first(sample, 14).unwrap(), correct);
+        }
+    }
+}

2022/src/day07.rs

@@ -0,0 +1,124 @@
+use anyhow::Context;
+use anyhow::Result;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take_until;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::combinator::opt;
+use nom::multi::fold_many0;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::parse_input;
+
+fn parse_dir<'a>(
+    input: &'a [u8],
+    dirs: &mut Vec<u32>,
+    dir_stack: &mut Vec<&'a [u8]>,
+) -> IResult<&'a [u8], u32> {
+    use nom::character::complete::u32;
+
+    enum Entry<'a> {
+        File(u32),
+        Dir(&'a [u8]),
+    }
+    let initial_len = dir_stack.len();
+
+    let (mut input, mut size) = preceded(
+        tag("$ ls\n"),
+        fold_many0(
+            // Map many newline-terminated entries
+            terminated(
+                // of either
+                alt((
+                    // A size followed by a name
+                    map(terminated(u32, take_until("\n")), Entry::File),
+                    // Or the word "dir" followed by a name
+                    map(preceded(tag("dir "), take_until("\n")), Entry::Dir),
+                )),
+                newline,
+            ),
+            || 0u32,
+            |files_sum, entry| match entry {
+                Entry::File(size) => files_sum + size,
+                Entry::Dir(name) => {
+                    dir_stack.push(name);
+                    files_sum
+                }
+            },
+        ),
+    )(input)?;
+
+    for i in initial_len..dir_stack.len() {
+        let (new_input, content_size) = delimited(
+            tuple((tag("$ cd "), tag(dir_stack[i]), newline)),
+            |input| parse_dir(input, dirs, dir_stack),
+            // Optional cd'ing out because the last directory is never exited.
+            opt(tag("$ cd ..\n")),
+        )(input)?;
+
+        input = new_input;
+        size += content_size;
+    }
+
+    dirs.push(size);
+    dir_stack.truncate(initial_len);
+
+    Ok((input, size))
+}
+
+fn parse_program(input: &[u8]) -> IResult<&[u8], (u32, Vec<u32>)> {
+    let mut dirs = Vec::new();
+    let mut dirstack = Vec::new();
+    let (input, size) = preceded(tag("$ cd /\n"), |input| {
+        parse_dir(input, &mut dirs, &mut dirstack)
+    })(input)?;
+
+    Ok((input, (size, dirs)))
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let (_, sizes) = parse_input(input, parse_program)?;
+
+    let searched_size: u32 = sizes.into_iter().filter(|&size| size <= 100000).sum();
+
+    Ok(searched_size.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    const TARGET: u32 = 30000000;
+    const TOTAL: u32 = 70000000;
+
+    let (used, sizes) = parse_input(input, parse_program)?;
+
+    let required = TARGET - (TOTAL - used);
+
+    let min = sizes
+        .into_iter()
+        .filter(|&size| size >= required)
+        .min()
+        .context("Did not find dir large enough to delete")?;
+
+    Ok(min.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/07.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "95437");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "24933642");
+    }
+}

2022/src/day08.rs

@@ -0,0 +1,163 @@
+use std::cmp::Ordering;
+
+use anyhow::Context;
+use anyhow::Result;
+
+#[inline]
+fn stripe<'a>(
+    values: impl IntoIterator<Item = &'a u8>,
+    visible: impl IntoIterator<Item = &'a mut bool>,
+) {
+    let mut max = 0;
+
+    for (&val, visible) in values.into_iter().zip(visible) {
+        if val > max {
+            max = val;
+            *visible = true;
+
+            if val == b'9' {
+                return;
+            }
+        }
+    }
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let width = input
+        .iter()
+        .position(|&b| b == b'\n')
+        .context("Single row field")?;
+    let height = input.len() / (width + 1); // Include newlines
+
+    let mut visible = vec![false; width * height];
+
+    // Horizontal striping
+    for (y, row) in input.chunks_exact(width + 1).enumerate() {
+        // First, left to right
+        stripe(&row[..width], &mut visible[(y * width)..]);
+
+        // Then right to left
+        stripe(
+            row[..width].iter().rev(),
+            visible[(y * width)..(y * width + width)].iter_mut().rev(),
+        );
+    }
+
+    // Vertical striping
+    for x in 0..width {
+        // Top to bottom
+        stripe(
+            input[x..].iter().step_by(width + 1),
+            visible[x..].iter_mut().step_by(width),
+        );
+
+        // Bottom to top
+        stripe(
+            input[x..].iter().step_by(width + 1).rev(),
+            visible[x..].iter_mut().step_by(width).rev(),
+        )
+    }
+
+    Ok(visible.into_iter().filter(|&b| b).count().to_string())
+}
+
+#[inline]
+fn scenery<'a>(
+    values: impl IntoIterator<Item = &'a u8>,
+    visible: impl IntoIterator<Item = &'a mut usize>,
+    tree_stack: &mut Vec<(usize, u8)>,
+) {
+    tree_stack.clear();
+
+    for (i, (&val, score)) in values.into_iter().zip(visible).enumerate() {
+        scenery_helper(i, tree_stack, val, score);
+    }
+}
+
+fn scenery_helper(i: usize, tree_stack: &mut Vec<(usize, u8)>, val: u8, score: &mut usize) {
+    if i > 0 {
+        let mut first = 0;
+
+        while let Some((pos, other)) = tree_stack.pop() {
+            match other.cmp(&val) {
+                Ordering::Less => (),
+                Ordering::Equal => {
+                    first = pos;
+                    break;
+                }
+                Ordering::Greater => {
+                    tree_stack.push((pos, other));
+                    first = pos;
+                    break;
+                }
+            }
+        }
+
+        tree_stack.push((i, val));
+
+        *score *= i - first;
+    } else {
+        *score = 0;
+    }
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let width = input
+        .iter()
+        .position(|&b| b == b'\n')
+        .context("Single row field")?;
+    let height = input.len() / (width + 1); // Include newlines
+
+    let mut score = vec![1; width * height];
+
+    let mut tree_stack = Vec::with_capacity(10);
+
+    // Horizontal striping
+    for (y, row) in input.chunks_exact(width + 1).enumerate() {
+        // First, left to right
+        scenery(&row[..width], &mut score[(y * width)..], &mut tree_stack);
+
+        // Then right to left
+        scenery(
+            row[..width].iter().rev(),
+            score[(y * width)..(y * width + width)].iter_mut().rev(),
+            &mut tree_stack,
+        );
+    }
+
+    // Vertical striping
+    for x in 0..width {
+        // Top to bottom
+        scenery(
+            input[x..].iter().step_by(width + 1),
+            score[x..].iter_mut().step_by(width),
+            &mut tree_stack,
+        );
+
+        // Bottom to top
+        scenery(
+            input[x..].iter().step_by(width + 1).rev(),
+            score[x..].iter_mut().step_by(width).rev(),
+            &mut tree_stack,
+        )
+    }
+
+    Ok(score.into_iter().max().context("empty field")?.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/08.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "21");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "8");
+    }
+}

2022/src/day09.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day10.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day11.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day12.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day13.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day14.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day15.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day16.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day17.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day18.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day19.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day20.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day21.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day22.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day23.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day24.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day25.rs

@@ -0,0 +1,5 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/lib.rs

@@ -0,0 +1,91 @@
+use anyhow::Result;
+
+mod common;
+mod day01;
+mod day02;
+mod day03;
+mod day04;
+mod day05;
+mod day06;
+mod day07;
+mod day08;
+mod day09;
+mod day10;
+mod day11;
+mod day12;
+mod day13;
+mod day14;
+mod day15;
+mod day16;
+mod day17;
+mod day18;
+mod day19;
+mod day20;
+mod day21;
+mod day22;
+mod day23;
+mod day24;
+mod day25;
+
+type Solution = fn(&[u8]) -> Result<String>;
+
+pub fn get_implementation(day: u8, part2: bool) -> Result<Solution> {
+    if !part2 {
+        match day {
+            1 => Ok(day01::part1),
+            2 => Ok(day02::part1),
+            3 => Ok(day03::part1),
+            4 => Ok(day04::part1),
+            5 => Ok(day05::part1),
+            6 => Ok(day06::part1),
+            7 => Ok(day07::part1),
+            8 => Ok(day08::part1),
+            9 => Ok(day09::part1),
+            10 => Ok(day10::part1),
+            11 => Ok(day11::part1),
+            12 => Ok(day12::part1),
+            13 => Ok(day13::part1),
+            14 => Ok(day14::part1),
+            15 => Ok(day15::part1),
+            16 => Ok(day16::part1),
+            17 => Ok(day17::part1),
+            18 => Ok(day18::part1),
+            19 => Ok(day19::part1),
+            20 => Ok(day20::part1),
+            21 => Ok(day21::part1),
+            22 => Ok(day22::part1),
+            23 => Ok(day23::part1),
+            24 => Ok(day24::part1),
+            25 => Ok(day25::part1),
+            _ => anyhow::bail!("Invalid day for part 1: {day}"),
+        }
+    } else {
+        match day {
+            1 => Ok(day01::part2),
+            2 => Ok(day02::part2),
+            3 => Ok(day03::part2),
+            4 => Ok(day04::part2),
+            5 => Ok(day05::part2),
+            6 => Ok(day06::part2),
+            7 => Ok(day07::part2),
+            8 => Ok(day08::part2),
+            9 => Ok(day09::part2),
+            10 => Ok(day10::part2),
+            11 => Ok(day11::part2),
+            12 => Ok(day12::part2),
+            13 => Ok(day13::part2),
+            14 => Ok(day14::part2),
+            15 => Ok(day15::part2),
+            16 => Ok(day16::part2),
+            17 => Ok(day17::part2),
+            18 => Ok(day18::part2),
+            19 => Ok(day19::part2),
+            20 => Ok(day20::part2),
+            21 => Ok(day21::part2),
+            22 => Ok(day22::part2),
+            23 => Ok(day23::part2),
+            24 => Ok(day24::part2),
+            _ => anyhow::bail!("Invalid day for part 2: {day}"),
+        }
+    }
+}

2022/src/main.rs

@@ -0,0 +1,61 @@
+use std::fs::File;
+use std::io::Read;
+use std::num::NonZeroU8;
+use std::path::PathBuf;
+use std::time::Instant;
+
+use anyhow::Result;
+use clap::Parser;
+
+use aoc_2022::get_implementation;
+
+/// Advent of Code 2022 runner
+#[derive(Parser)]
+struct Opts {
+    /// Which day to run
+    day: NonZeroU8,
+
+    /// Print time taken
+    #[clap(short, long)]
+    time: bool,
+
+    /// Run part 2 instead of part 1
+    #[clap(short = '2', long)]
+    part2: bool,
+
+    /// Read input from the given file instead of stdin
+    #[clap(short, long)]
+    input: Option<PathBuf>,
+}
+
+impl Opts {
+    fn input_data(&self) -> Result<Vec<u8>> {
+        let mut buffer = Vec::new();
+
+        if let Some(input) = &self.input {
+            File::open(input)?.read_to_end(&mut buffer)?;
+        } else {
+            std::io::stdin().read_to_end(&mut buffer)?;
+        }
+
+        Ok(buffer)
+    }
+}
+
+fn main() -> Result<()> {
+    let opts: Opts = Opts::parse();
+
+    let input = opts.input_data()?;
+
+    let implementation = get_implementation(opts.day.get(), opts.part2)?;
+
+    let begin = Instant::now();
+    let result = implementation(&input)?;
+
+    if opts.time {
+        eprintln!("Execution time: {:?}", Instant::now().duration_since(begin));
+    }
+
+    println!("{}", result);
+    Ok(())
+}

2022/src/samples/01.txt

@@ -0,0 +1,14 @@
+1000
+2000
+3000
+
+4000
+
+5000
+6000
+
+7000
+8000
+9000
+
+10000

2022/src/samples/02.txt

@@ -0,0 +1,3 @@
+A Y
+B X
+C Z

2022/src/samples/03.txt

@@ -0,0 +1,6 @@
+vJrwpWtwJgWrhcsFMMfFFhFp
+jqHRNqRjqzjGDLGLrsFMfFZSrLrFZsSL
+PmmdzqPrVvPwwTWBwg
+wMqvLMZHhHMvwLHjbvcjnnSBnvTQFn
+ttgJtRGJQctTZtZT
+CrZsJsPPZsGzwwsLwLmpwMDw

2022/src/samples/04.txt

@@ -0,0 +1,6 @@
+2-4,6-8
+2-3,4-5
+5-7,7-9
+2-8,3-7
+6-6,4-6
+2-6,4-8

2022/src/samples/05.txt

@@ -0,0 +1,9 @@
+    [D]    
+[N] [C]    
+[Z] [M] [P]
+ 1   2   3 
+
+move 1 from 2 to 1
+move 3 from 1 to 3
+move 2 from 2 to 1
+move 1 from 1 to 2

2022/src/samples/07.txt

@@ -0,0 +1,23 @@
+$ cd /
+$ ls
+dir a
+14848514 b.txt
+8504156 c.dat
+dir d
+$ cd a
+$ ls
+dir e
+29116 f
+2557 g
+62596 h.lst
+$ cd e
+$ ls
+584 i
+$ cd ..
+$ cd ..
+$ cd d
+$ ls
+4060174 j
+8033020 d.log
+5626152 d.ext
+7214296 k

2022/src/samples/08.txt

@@ -0,0 +1,5 @@
+30373
+25512
+65332
+33549
+35390

README.md

@@ -1,6 +1,6 @@
 # Advent of Code
 
-[![Advent of Code 2021](https://github.com/bertptrs/adventofcode/actions/workflows/2021.yml/badge.svg)](https://github.com/bertptrs/adventofcode/actions/workflows/2021.yml)
+[![Advent of Code 2021](https://github.com/bertptrs/adventofcode/actions/workflows/2022.yml/badge.svg)](https://github.com/bertptrs/adventofcode/actions/workflows/2022.yml)
 
 This repository contains my solutions for Advent of Code. See:
 
@@ -11,3 +11,4 @@ This repository contains my solutions for Advent of Code. See:
 - [2019 edition](./2019)
 - [2020 edition](./2020)
 - [2021 edition](./2021)
+- [2022 edition](./2022)