Slightly better ICACHE hits

230 byte overhead is worth it to avoid conversions and potential
indexing errors

2022/benches/days.rs

@@ -8,7 +8,7 @@ use criterion::BenchmarkId;
 use criterion::Criterion;
 
 /// Number of days we have an implementation to benchmark
-const DAYS_IMPLEMENTED: u8 = 4;
+const DAYS_IMPLEMENTED: u8 = 25;
 
 fn read_input(day: u8) -> Vec<u8> {
     let input_path = format!("inputs/{:02}.txt", day);

2022/inputs/05.txt

@@ -0,0 +1,514 @@
+        [G]         [D]     [Q]    
+[P]     [T]         [L] [M] [Z]    
+[Z] [Z] [C]         [Z] [G] [W]    
+[M] [B] [F]         [P] [C] [H] [N]
+[T] [S] [R]     [H] [W] [R] [L] [W]
+[R] [T] [Q] [Z] [R] [S] [Z] [F] [P]
+[C] [N] [H] [R] [N] [H] [D] [J] [Q]
+[N] [D] [M] [G] [Z] [F] [W] [S] [S]
+ 1   2   3   4   5   6   7   8   9 
+
+move 7 from 6 to 8
+move 5 from 2 to 6
+move 2 from 4 to 1
+move 1 from 4 to 5
+move 5 from 7 to 6
+move 7 from 6 to 3
+move 5 from 9 to 2
+move 6 from 2 to 3
+move 2 from 7 to 9
+move 20 from 3 to 1
+move 11 from 1 to 6
+move 1 from 9 to 8
+move 3 from 8 to 2
+move 8 from 1 to 5
+move 10 from 8 to 4
+move 7 from 6 to 4
+move 1 from 8 to 3
+move 8 from 1 to 7
+move 16 from 4 to 8
+move 1 from 9 to 8
+move 1 from 5 to 2
+move 4 from 7 to 4
+move 5 from 6 to 7
+move 1 from 6 to 1
+move 8 from 7 to 4
+move 1 from 6 to 9
+move 12 from 4 to 5
+move 3 from 2 to 5
+move 1 from 6 to 2
+move 1 from 3 to 7
+move 1 from 3 to 2
+move 1 from 9 to 3
+move 1 from 7 to 8
+move 1 from 7 to 5
+move 1 from 3 to 2
+move 4 from 5 to 7
+move 5 from 5 to 7
+move 1 from 4 to 3
+move 1 from 3 to 9
+move 3 from 1 to 8
+move 1 from 9 to 1
+move 2 from 2 to 1
+move 2 from 2 to 7
+move 8 from 8 to 1
+move 3 from 5 to 2
+move 8 from 7 to 5
+move 7 from 1 to 3
+move 3 from 1 to 7
+move 1 from 1 to 5
+move 1 from 3 to 7
+move 7 from 5 to 8
+move 2 from 2 to 8
+move 1 from 3 to 2
+move 1 from 2 to 4
+move 1 from 4 to 8
+move 13 from 8 to 1
+move 13 from 5 to 9
+move 2 from 5 to 2
+move 7 from 9 to 3
+move 12 from 8 to 3
+move 4 from 9 to 3
+move 1 from 3 to 4
+move 2 from 2 to 3
+move 1 from 1 to 6
+move 1 from 2 to 3
+move 1 from 5 to 9
+move 7 from 7 to 4
+move 10 from 1 to 8
+move 1 from 1 to 4
+move 1 from 9 to 5
+move 2 from 5 to 1
+move 1 from 6 to 5
+move 3 from 8 to 9
+move 5 from 4 to 3
+move 4 from 4 to 1
+move 7 from 1 to 6
+move 2 from 5 to 7
+move 35 from 3 to 4
+move 4 from 9 to 1
+move 19 from 4 to 8
+move 1 from 7 to 6
+move 1 from 9 to 2
+move 10 from 4 to 5
+move 2 from 4 to 7
+move 3 from 4 to 3
+move 1 from 2 to 8
+move 1 from 1 to 9
+move 3 from 3 to 6
+move 4 from 8 to 6
+move 4 from 5 to 2
+move 2 from 8 to 3
+move 3 from 5 to 9
+move 12 from 6 to 1
+move 8 from 8 to 6
+move 2 from 9 to 1
+move 1 from 4 to 1
+move 1 from 3 to 8
+move 3 from 7 to 8
+move 2 from 9 to 7
+move 1 from 6 to 7
+move 10 from 6 to 8
+move 4 from 2 to 5
+move 1 from 3 to 7
+move 7 from 5 to 7
+move 13 from 8 to 1
+move 29 from 1 to 4
+move 8 from 7 to 8
+move 1 from 1 to 3
+move 3 from 7 to 6
+move 1 from 1 to 9
+move 15 from 4 to 1
+move 1 from 3 to 6
+move 10 from 1 to 6
+move 10 from 6 to 7
+move 1 from 4 to 9
+move 1 from 9 to 1
+move 1 from 9 to 7
+move 6 from 7 to 8
+move 1 from 1 to 6
+move 5 from 6 to 5
+move 21 from 8 to 9
+move 5 from 1 to 9
+move 2 from 9 to 5
+move 3 from 5 to 6
+move 3 from 7 to 9
+move 4 from 4 to 6
+move 6 from 8 to 7
+move 6 from 6 to 3
+move 2 from 7 to 9
+move 1 from 7 to 2
+move 6 from 3 to 2
+move 1 from 6 to 4
+move 4 from 5 to 9
+move 1 from 4 to 5
+move 9 from 4 to 6
+move 7 from 6 to 4
+move 10 from 9 to 2
+move 5 from 7 to 5
+move 10 from 2 to 7
+move 2 from 5 to 4
+move 2 from 5 to 9
+move 4 from 9 to 4
+move 1 from 8 to 6
+move 7 from 7 to 2
+move 1 from 5 to 4
+move 2 from 7 to 1
+move 1 from 5 to 7
+move 3 from 6 to 2
+move 4 from 4 to 5
+move 1 from 2 to 7
+move 10 from 4 to 7
+move 3 from 7 to 3
+move 17 from 9 to 4
+move 1 from 1 to 4
+move 1 from 1 to 5
+move 5 from 2 to 7
+move 1 from 9 to 2
+move 5 from 4 to 8
+move 2 from 9 to 7
+move 4 from 8 to 1
+move 3 from 4 to 8
+move 1 from 2 to 5
+move 1 from 9 to 2
+move 6 from 4 to 8
+move 3 from 7 to 5
+move 1 from 4 to 9
+move 1 from 9 to 1
+move 3 from 1 to 9
+move 4 from 8 to 5
+move 2 from 9 to 8
+move 4 from 2 to 5
+move 8 from 7 to 2
+move 5 from 8 to 5
+move 2 from 7 to 8
+move 1 from 3 to 5
+move 1 from 1 to 2
+move 1 from 1 to 6
+move 2 from 3 to 6
+move 5 from 2 to 8
+move 4 from 7 to 1
+move 7 from 8 to 5
+move 1 from 1 to 5
+move 3 from 8 to 3
+move 1 from 9 to 3
+move 7 from 2 to 3
+move 2 from 2 to 8
+move 2 from 4 to 8
+move 1 from 8 to 5
+move 1 from 1 to 4
+move 2 from 4 to 7
+move 2 from 7 to 1
+move 3 from 2 to 3
+move 3 from 5 to 2
+move 1 from 8 to 3
+move 3 from 3 to 2
+move 5 from 2 to 1
+move 17 from 5 to 8
+move 9 from 8 to 1
+move 11 from 3 to 5
+move 8 from 8 to 5
+move 2 from 8 to 5
+move 16 from 1 to 4
+move 13 from 4 to 7
+move 6 from 5 to 2
+move 2 from 4 to 8
+move 5 from 7 to 9
+move 2 from 1 to 2
+move 7 from 7 to 1
+move 1 from 1 to 4
+move 1 from 9 to 8
+move 7 from 2 to 8
+move 1 from 4 to 7
+move 2 from 9 to 4
+move 1 from 4 to 1
+move 1 from 3 to 5
+move 2 from 9 to 8
+move 11 from 8 to 7
+move 2 from 6 to 5
+move 1 from 6 to 9
+move 1 from 1 to 9
+move 1 from 9 to 1
+move 4 from 1 to 4
+move 2 from 1 to 8
+move 1 from 1 to 2
+move 1 from 9 to 5
+move 2 from 4 to 3
+move 2 from 2 to 7
+move 2 from 3 to 9
+move 1 from 9 to 1
+move 1 from 9 to 1
+move 5 from 5 to 1
+move 19 from 5 to 6
+move 5 from 1 to 4
+move 1 from 2 to 9
+move 1 from 1 to 3
+move 7 from 5 to 8
+move 1 from 3 to 6
+move 8 from 7 to 3
+move 7 from 4 to 8
+move 3 from 8 to 5
+move 1 from 4 to 1
+move 1 from 9 to 4
+move 1 from 4 to 9
+move 1 from 5 to 2
+move 2 from 5 to 6
+move 2 from 8 to 2
+move 7 from 8 to 1
+move 1 from 1 to 7
+move 3 from 6 to 9
+move 2 from 3 to 2
+move 1 from 2 to 1
+move 1 from 8 to 7
+move 2 from 9 to 6
+move 2 from 9 to 5
+move 1 from 5 to 6
+move 1 from 2 to 8
+move 2 from 1 to 7
+move 1 from 4 to 3
+move 3 from 2 to 5
+move 7 from 1 to 3
+move 10 from 3 to 4
+move 3 from 5 to 4
+move 1 from 3 to 8
+move 3 from 3 to 2
+move 1 from 8 to 1
+move 1 from 1 to 3
+move 3 from 8 to 3
+move 5 from 4 to 6
+move 1 from 2 to 3
+move 4 from 6 to 4
+move 1 from 5 to 7
+move 4 from 3 to 4
+move 1 from 2 to 8
+move 12 from 7 to 6
+move 1 from 8 to 2
+move 2 from 2 to 7
+move 1 from 8 to 4
+move 23 from 6 to 3
+move 14 from 3 to 6
+move 15 from 4 to 6
+move 1 from 8 to 6
+move 10 from 3 to 7
+move 2 from 4 to 2
+move 11 from 7 to 8
+move 2 from 2 to 6
+move 44 from 6 to 9
+move 21 from 9 to 3
+move 12 from 3 to 6
+move 1 from 7 to 4
+move 1 from 4 to 7
+move 9 from 3 to 2
+move 2 from 8 to 6
+move 3 from 2 to 4
+move 17 from 9 to 1
+move 3 from 4 to 6
+move 2 from 2 to 9
+move 4 from 9 to 2
+move 10 from 6 to 9
+move 1 from 7 to 6
+move 4 from 9 to 5
+move 4 from 2 to 4
+move 14 from 1 to 5
+move 4 from 4 to 3
+move 3 from 2 to 9
+move 9 from 9 to 7
+move 1 from 2 to 5
+move 9 from 8 to 5
+move 8 from 7 to 2
+move 4 from 3 to 8
+move 5 from 6 to 2
+move 3 from 1 to 6
+move 1 from 7 to 1
+move 4 from 2 to 4
+move 3 from 6 to 4
+move 3 from 8 to 3
+move 13 from 5 to 2
+move 2 from 3 to 5
+move 12 from 5 to 9
+move 1 from 3 to 5
+move 1 from 5 to 9
+move 1 from 8 to 3
+move 4 from 9 to 5
+move 6 from 4 to 5
+move 12 from 9 to 7
+move 1 from 9 to 3
+move 1 from 3 to 2
+move 12 from 5 to 6
+move 12 from 7 to 2
+move 1 from 3 to 7
+move 1 from 4 to 8
+move 33 from 2 to 8
+move 1 from 7 to 5
+move 1 from 1 to 2
+move 4 from 5 to 4
+move 3 from 2 to 5
+move 34 from 8 to 6
+move 1 from 4 to 3
+move 1 from 5 to 7
+move 1 from 7 to 5
+move 3 from 4 to 9
+move 2 from 9 to 7
+move 1 from 9 to 4
+move 1 from 3 to 7
+move 1 from 5 to 8
+move 1 from 5 to 1
+move 1 from 5 to 7
+move 1 from 4 to 8
+move 1 from 1 to 4
+move 1 from 4 to 2
+move 3 from 7 to 5
+move 2 from 8 to 5
+move 1 from 2 to 8
+move 4 from 6 to 2
+move 1 from 8 to 6
+move 1 from 7 to 9
+move 29 from 6 to 7
+move 4 from 2 to 3
+move 2 from 5 to 8
+move 1 from 9 to 5
+move 2 from 8 to 1
+move 23 from 7 to 5
+move 2 from 6 to 1
+move 23 from 5 to 6
+move 1 from 3 to 6
+move 4 from 5 to 9
+move 2 from 1 to 3
+move 5 from 3 to 8
+move 2 from 6 to 5
+move 2 from 1 to 4
+move 1 from 9 to 8
+move 1 from 9 to 1
+move 1 from 4 to 6
+move 2 from 5 to 6
+move 6 from 7 to 8
+move 2 from 9 to 2
+move 18 from 6 to 5
+move 21 from 6 to 4
+move 1 from 1 to 6
+move 2 from 6 to 7
+move 2 from 7 to 9
+move 2 from 2 to 8
+move 7 from 4 to 3
+move 12 from 5 to 3
+move 1 from 9 to 5
+move 1 from 9 to 4
+move 6 from 5 to 2
+move 17 from 3 to 4
+move 3 from 4 to 3
+move 1 from 2 to 4
+move 5 from 2 to 8
+move 1 from 5 to 8
+move 19 from 8 to 7
+move 1 from 3 to 6
+move 1 from 8 to 4
+move 1 from 6 to 1
+move 15 from 4 to 6
+move 1 from 1 to 4
+move 3 from 3 to 5
+move 4 from 6 to 7
+move 1 from 4 to 7
+move 10 from 6 to 7
+move 16 from 4 to 5
+move 24 from 7 to 2
+move 8 from 7 to 8
+move 1 from 4 to 2
+move 6 from 8 to 7
+move 1 from 8 to 7
+move 1 from 6 to 9
+move 14 from 5 to 4
+move 9 from 7 to 8
+move 4 from 5 to 1
+move 2 from 1 to 5
+move 3 from 8 to 6
+move 2 from 6 to 9
+move 2 from 2 to 8
+move 6 from 2 to 7
+move 3 from 4 to 6
+move 1 from 3 to 4
+move 3 from 5 to 7
+move 1 from 6 to 9
+move 5 from 7 to 2
+move 4 from 9 to 1
+move 1 from 7 to 9
+move 9 from 8 to 4
+move 5 from 1 to 2
+move 2 from 6 to 1
+move 6 from 4 to 7
+move 1 from 7 to 3
+move 1 from 3 to 9
+move 1 from 9 to 7
+move 1 from 6 to 7
+move 9 from 4 to 5
+move 7 from 7 to 9
+move 3 from 7 to 5
+move 1 from 9 to 2
+move 6 from 9 to 8
+move 4 from 4 to 5
+move 1 from 4 to 2
+move 1 from 4 to 2
+move 2 from 1 to 2
+move 1 from 9 to 8
+move 10 from 2 to 4
+move 8 from 2 to 7
+move 12 from 2 to 9
+move 6 from 7 to 4
+move 1 from 1 to 2
+move 8 from 9 to 8
+move 7 from 5 to 1
+move 9 from 4 to 3
+move 14 from 8 to 4
+move 1 from 8 to 4
+move 1 from 1 to 5
+move 1 from 5 to 2
+move 3 from 2 to 4
+move 1 from 7 to 1
+move 1 from 7 to 3
+move 2 from 1 to 7
+move 3 from 5 to 7
+move 2 from 7 to 6
+move 1 from 6 to 5
+move 3 from 7 to 1
+move 1 from 6 to 8
+move 1 from 8 to 7
+move 1 from 3 to 6
+move 1 from 7 to 1
+move 4 from 1 to 4
+move 6 from 3 to 2
+move 3 from 1 to 2
+move 3 from 3 to 6
+move 3 from 2 to 6
+move 6 from 6 to 5
+move 1 from 1 to 4
+move 1 from 9 to 6
+move 5 from 2 to 1
+move 3 from 1 to 2
+move 2 from 9 to 8
+move 3 from 1 to 5
+move 1 from 9 to 7
+move 25 from 4 to 1
+move 1 from 1 to 7
+move 2 from 8 to 3
+move 13 from 1 to 9
+move 2 from 3 to 5
+move 8 from 5 to 9
+move 4 from 2 to 1
+move 2 from 6 to 7
+move 10 from 5 to 9
+move 4 from 7 to 2
+move 2 from 2 to 3
+move 9 from 9 to 2
+move 4 from 4 to 5
+move 4 from 5 to 4
+move 5 from 1 to 4
+move 10 from 4 to 5
+move 22 from 9 to 1
+move 2 from 2 to 7
+move 3 from 2 to 1
+move 6 from 2 to 6
+move 1 from 7 to 1
+move 10 from 5 to 7
+move 15 from 1 to 4
+move 13 from 1 to 5
+move 3 from 6 to 8
+move 1 from 8 to 9

2022/inputs/06.txt

@@ -0,0 +1 @@
+grvrnvrnnjljbjqjpqjjvhhzwwrbwwbblrltrrpbbbbqnnqbbbbsvbvmbvmbbrsrqrzrllwbbbqzqrqnqrnrjnnjccdggwqqhrrjcjmjmllgrlglhlclmlvlvsshwwsggmfmdfddgdfftrrczrcczhzppgdgrdggghmmdwwqgggslglfgfcgccmjcjwjrwjrjcrjjsgjjvddpwpgpbbgwbgwwhnhfftbffhpfphhfqfrqfrfnfpprvrsrhrfrllfhhrsrhssvfsvsnvsnsswtwtlthllrjjwddtggzczgcchwcwppfbbdvdrdzrdrvrwwsbsfbssqfsfjsjcscttlztllgjjlbbdsdtssvvvwlvlqqnhqqtdqtddjcdcjjpbphhgtgtqtzqqzhqqtgtvtmvtvrvqrvvfmfmppzzbwwnddzttfpfrrlddbppfqppnwnswwdhwdwjjqljqqthtnhnddgmgcmgcmgcmmfmfttrzzfdzztllmjlllgcgbbcqcvccpnndbdjbjmmzbztzptzpprpddptpprhhvlvmlmpmmljjnnjsjfjjvgjjvzzfgfzfbftbftttgstgstgtpggflfcfqqtctltgltldlzdlzzmmlddnvddzfddppmnpptzptpvttwstwswvwrvvbfbjjjbmjjdvdvrvdddrwrhrzrqqhghhrwhwhrrmppsgpsgszzdfdfwwmtwtvwvgvffmqqqtqntqnnjcncbnbwnnzggrdrqqjbqjjwjqqqwlqwlwzlljhhfsfsqsrqqhwqqwbbqbvvlflrrlglbbjhhjmhjjcmcjcgczcfcgcqqczcnnvjnnlddmpmcppgvgjgddvrrnsnmnqmqgmmnppwgwcgwgssbddgtdgdgmdgmgvvmjmvmjmvvsfssdgdghdggbfbqbdbjbsbmmrpmrprggbllwrwpwtppzvppzsssdnsdnnvnhvvvzvfzfqqnnmlnltldtdvdbdblddsmmlccmlmvlmvmmcsctctrtsrstsbsrshsddlmddmppgsscttnrtrqqcvcwwlnlznnnvcnvvtnvnbnmbmvmppjgjdjtddmpdmdvvmgvvdqdlqlhhzccsggjdjsdsttctjctjtfjttppdzpzzbjbwwmwbblslzslzszlzrrcbrrfggvcczjjtbbdnnggbwblwlbwlwqqfvfqfddrrfccvlllhmhhhrthrthrrnbnzbbpzplphprrrnbbghhnshnhbblqqqvwwffnmnmhhtccpqpvqvbvnvvfnfsnffdjdllwffcddgcgrgjrggchcpcddtbbdtdmtdmmhhtphtpppclcpcvcjvcjjfqfzqqphpnhnrnhhpdhhtfhhbbmqmfmsmvssgqqfssqgglnnqmnmbnmbbllrdrgdrdvrdvdsvvnddgtgddcdqdsqdqbqqlhhwdhdgdcgcdchchrchhpvvpgvgrrfggwfwgmpddbhfngtrwswfszgsggnpsntjpslrpjqsffzrlnbnzdtqpqtjzwlhhgrsrbvnccnsjmzcbqgcbtbqlzhnpnhhrrvqwjwzzvrlcrmjhcscrqhpqmfzbnvcwwqhcjjlnggmpbwztzfswmsbjshnsgfmdlzvzczhrdwgwbghszpnbfpctrshbfhspsczcqcrrqcpwwpfzhjqtpqgjbztrpzrlgfdjbmlwdvlvnfmdzbwsbbhlbszvwcpztlchjrqbmsftltmqpfgdpmdgjvwqqtjsqlfqrwmsnlqgsbqfwsdnfvzthmbplvszfcmlptlcjpnfpjsphsmmjplwjqphgvzbtbjtpttqhlwtgnrjvmvsfsztmsqszzlhqqhfslsvhzgtsssfctzgsqbgdzlpwbsmpcnjqshhhcwqdsdzdhnjfqzqnqdlrpddcgrgldgqbjmdtwgppdczzrjvmcfqjbpjzbtjmgdphlbwnsnpfdqlhwvvmpwzsrztnwvtlbphljmjwsgbphgmwhdmfhpvsmvsjccjhfvqtvfmmlnggncltvtrgmbtfqsvfnlvcmjnjwzcrpjnsgntvhjbtdlptshbhhchqmsprhqzdnfpjqccdfvnzjtlbsmmwvzlwlvmsbrnhqctvtvbfhntdctjnrbcrrlmsnwbbjbcbbgrrhfqwzwwfgvsvgbwnttghtgpspzwzfhffsqjvwwttntnvlwftsfvtttgnprzrzsghvjrdtsfdvzswhmrfcdqsgvrlhzbnvbmjlqrftnnbtwqtvlvwznfbslhdqjbntdgpprfqchjvgvzjssdztjlzwfljjmfvzrbbtczggzqwrnqqgzzcbqjcpfqfrbwtdjrrvbszsjdjcpdfjscsvnltcgwvqsgnhbfgnfnddnpmbzbptrmvqzpvbdpfdvtlmgnnjwflgdbfnmvsdnmlvgcpwflwvdbtbfwtfpsmqsplnzwlwgvbjrhghwrnrswsggbqpdjcjrgbgnsqdvwzzwftvjqgjzzcdvpbbjzpphmbcqmrjvgqwfgrsnqvhwflmhgrlvbpwdcsrlqwfrwppqbrdhwqtvczpclpsbsjcptgblbbsqmbhjjgzwvlcnhnzcttmpjsgchmppgphqlzlcsqcgbbjgtjjvmttdztfdptzgvmpnqrcmpmcdlpnbztllvqbggqbqhlqvdwsrwzsjwfrqvcbvsgfdptmrzpvdfblmhlzrvpmsljlqqzrhlnmwncpfhvqlsbtrjbfcrnfvjvddrhdbbczjdsrdvzlbqrccssdzcpmdsqbprjppfzdwfdswptgzcmjqfhcwsqfqhvrslffqfbcvhdzljzrmtwmfdwzdhhjcmbjtvjhzzwfqhrcslztdbnlwmmhbbbgdscjcdzftnchqfnflnsdqjscfrqpnfbftpzvtmrwncqfqqflschpfnjsjlqcjdjgtwpqhgcnjdmnnvmmpwdspmnrgqrptqwcvbtdwpqlbtwpqgwgfrzlrhtvrvzhmhmwhfdsrhpcczqfltsgtgrfwcvlcvtlhqqwnrqgzpnzbfmzbdwqwbsfvbshrgzqdbgvrhzhzlbqsfzttmsnmrqmwgtzbvdqdrbgcpclzjrhdbjtpcdbbznjgtbwbqrnpvffdmwtrbhhstcmnjcwbbnmpbvmjprtzgcptmtrffwhvfgdljnrbbrblbfbgdwtjrtgqgrpvpgjqrjzczvvlspgdbzftqgqvgdqlglbgvgjdcztznszcwfqhmwbrbjcfstzdcmdsssqfhtzpdgmzjscvbdzgbhhgdqgvfwrzmhdrhlsvlzjjzbzdljcbhncppwrtptjgszlqsrqpzqcsgvdvzmgvwgsncnbffttslphcstqvfwbwzbflmshcbnhpljgqwmmwwzlgpbcqnrtqlwcjcrclfdrnnmvtbfdztdfvtqrsgdptfcfpzpsldhzmrngggfvdqggtlfqqwsldprcffsstnnpmsbbvghdbpprqbssnprdbqclzqtgsrczwcvqwrrfmmfwsndvtvqljwwglrgbphdvvwgctbbmtrbpzqtspgrlhmnhjcdwhwvssgspzjbcfjttjqbdpdmptfzzjcfqljpqddfssmffqprvbptfvdshsdmfmdtmlbnmbmjjjsgmlmwmgcwhbrbgchrstptvdlqgddfzddlzhwjmsvvcjwvqtzjtsctfmzchlbrvlgdzbvdlbfpvhptpltrdmcgjghcpwvwqqnrzdtnmgdncplhdpsgpnbprbgshffwwsdhpgqsbmwdtpnhhltlcqfrjtswcchzvlhdgrmjwhgwppdjqlgmdhwbllqvzrchgclmqdlghjsvmwlflmhhmdzbfjhjnvwphnjbclmdpgflqgtfsmsjslntfcmtbphnrgpdcqtjzjttdtgjmvhzsrfnrjqssvwpcslpfstbpfsrsntmftmdgsqrrsnddqfmchrhtlhmqndvvllnvltdzfphjqnvmcdsgfpcmjftgdpntjzplqljhtthvnbzbzwvfnqsjvnfwhmtbsspjslgfjvdgfjpwrsgqwntntjcqtdgnhnsfwhhqfwbwhdrftj

2022/inputs/07.txt

@@ -0,0 +1,983 @@
+$ cd /
+$ ls
+dir gqcclj
+dir lmtpm
+dir nhqwt
+dir qcq
+dir vwqwlqrt
+$ cd gqcclj
+$ ls
+62425 dqp.gjm
+174181 hrtw.qsd
+273712 pflp.mdw
+169404 zlthnlhf.mtn
+180878 zprprf
+$ cd ..
+$ cd lmtpm
+$ ls
+dir clffsvcw
+163587 cvcl.jqh
+dir dcqnblb
+dir dtpwln
+dir fvt
+dir hrcrw
+dir jdqzmqn
+236754 nrdmlj
+205959 pflp.mdw
+dir qcq
+dir rsn
+129926 vdgcqdn.sqd
+dir zprprf
+$ cd clffsvcw
+$ ls
+6997 dcqnblb.wbh
+145711 dqp
+159225 pflp.mdw
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir dcqnblb
+dir gfn
+dir lpswsp
+dir lvt
+dir zprprf
+$ cd dcqnblb
+$ ls
+2020 grpdmd.ggz
+dir zpswzfvg
+$ cd zpswzfvg
+$ ls
+206998 zprprf.gnw
+$ cd ..
+$ cd ..
+$ cd gfn
+$ ls
+277530 rhbvtblc.mvw
+$ cd ..
+$ cd lpswsp
+$ ls
+173180 dcqnblb
+$ cd ..
+$ cd lvt
+$ ls
+dir hjllwsvl
+dir ptbt
+$ cd hjllwsvl
+$ ls
+dir wqnc
+$ cd wqnc
+$ ls
+64695 grpdmd.ggz
+$ cd ..
+$ cd ..
+$ cd ptbt
+$ ls
+150880 vvbt.gtp
+$ cd ..
+$ cd ..
+$ cd zprprf
+$ ls
+dir ldzslndn
+dir qftt
+$ cd ldzslndn
+$ ls
+dir bwqqsbhg
+129454 vbn
+$ cd bwqqsbhg
+$ ls
+108701 zprprf.gss
+$ cd ..
+$ cd ..
+$ cd qftt
+$ ls
+64268 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dtpwln
+$ ls
+196215 cvcl.jqh
+dir dpwg
+dir ldzslndn
+dir znnsqqh
+$ cd dpwg
+$ ls
+192388 gmh
+47754 grgzh.qdl
+99449 hqsh
+dir pbmf
+50061 pflp.mdw
+192902 qcq.pgg
+dir rmpvj
+dir scgc
+$ cd pbmf
+$ ls
+210083 wpfnwbl.mgf
+$ cd ..
+$ cd rmpvj
+$ ls
+125738 nmlnbvrd
+226214 zprprf.jnp
+114257 zprprf.srs
+$ cd ..
+$ cd scgc
+$ ls
+182115 rrc.rcc
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+201992 qcrm.cpd
+$ cd ..
+$ cd znnsqqh
+$ ls
+85635 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd fvt
+$ ls
+dir dcqnblb
+dir gnc
+75864 vfn
+$ cd dcqnblb
+$ ls
+dir dcqnblb
+dir lbnflwsh
+$ cd dcqnblb
+$ ls
+269901 cvcl.jqh
+$ cd ..
+$ cd lbnflwsh
+$ ls
+33336 grpdmd.ggz
+42861 phg.wmc
+$ cd ..
+$ cd ..
+$ cd gnc
+$ ls
+dir jhjbjsp
+dir jjppr
+$ cd jhjbjsp
+$ ls
+96177 ldzslndn
+$ cd ..
+$ cd jjppr
+$ ls
+181016 dqp
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd hrcrw
+$ ls
+261376 dtjfpppr.dww
+54658 vsrgvw.pfn
+$ cd ..
+$ cd jdqzmqn
+$ ls
+52342 dcpndc.vlg
+171946 gggpchh.tbb
+dir ldzslndn
+11156 nbfrfvv.gzw
+$ cd ldzslndn
+$ ls
+107873 cvcl.jqh
+216034 gfdjrbz
+68844 pqllfrrh.jcf
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+152886 ldzslndn.ltn
+105125 vwplh.vbf
+$ cd ..
+$ cd rsn
+$ ls
+15385 hqcmjdgv.jjv
+105735 qcq.bzg
+58805 snczcsp
+26668 vbn
+$ cd ..
+$ cd zprprf
+$ ls
+dir chbmq
+dir dcqnblb
+dir dqp
+dir nfspb
+89506 zprprf.hnt
+$ cd chbmq
+$ ls
+dir cnjvw
+dir dqp
+151434 frsvrdnt
+dir msztjvcb
+240689 qcq.jlh
+dir sjzrcg
+97312 vnr.zfr
+dir zprprf
+$ cd cnjvw
+$ ls
+dir bpbs
+252403 cqhtshc
+dir djmjhn
+10935 fhqmswr
+6582 pdwml.ldd
+dir qcq
+219282 rfmd
+$ cd bpbs
+$ ls
+147582 bnhwsnsj.gdm
+61362 cvcl.jqh
+152857 vdgcqdn.sqd
+$ cd ..
+$ cd djmjhn
+$ ls
+dir bjdbcjbb
+dir dcqnblb
+dir dqp
+dir lgdwtt
+$ cd bjdbcjbb
+$ ls
+110710 cvcl.jqh
+252792 hmshctr.lgz
+dir mjhtmbj
+189745 shsswcgr
+dir tfnhp
+194940 vbn
+dir zprprf
+$ cd mjhtmbj
+$ ls
+dir dqp
+dir hbthpcmb
+$ cd dqp
+$ ls
+200832 sbcrz.qgw
+$ cd ..
+$ cd hbthpcmb
+$ ls
+55191 ffcntg
+$ cd ..
+$ cd ..
+$ cd tfnhp
+$ ls
+276825 dqp
+161538 gqmr.wgb
+$ cd ..
+$ cd zprprf
+$ ls
+287638 dcqnblb.ssp
+41274 hgmrvj.mwf
+249118 sbb.gsf
+105141 wwrg.gqz
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+1957 btmmc
+32386 dtzbzg.dhm
+dir mmrbj
+98283 ntmhfgtl.pmf
+dir zprprf
+$ cd mmrbj
+$ ls
+273194 wnsq
+251527 zprprf
+$ cd ..
+$ cd zprprf
+$ ls
+27678 ldzslndn.rrl
+62866 ljf.fdj
+148502 qcq.dlg
+dir rvgqvm
+179231 tllnmhn.pjp
+64033 vbn
+dir zcdrj
+$ cd rvgqvm
+$ ls
+dir ntbv
+262324 prhgj.szz
+dir qbvdh
+$ cd ntbv
+$ ls
+116608 cgv.fvj
+175200 swpswq.twt
+$ cd ..
+$ cd qbvdh
+$ ls
+160353 sdhfrb.wjn
+$ cd ..
+$ cd ..
+$ cd zcdrj
+$ ls
+283262 ctl
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir jfzm
+111438 rdrgb.mjf
+64194 wgtmqrq
+dir zprprf
+$ cd jfzm
+$ ls
+158774 pflp.mdw
+$ cd ..
+$ cd zprprf
+$ ls
+215264 sgsstcp
+$ cd ..
+$ cd ..
+$ cd lgdwtt
+$ ls
+dir qcq
+$ cd qcq
+$ ls
+165461 ldzslndn.vvb
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+dir dpd
+165044 grpdmd.ggz
+82343 ldzslndn
+dir mwg
+176689 psjcwp.wct
+44404 qcq.zwd
+$ cd dpd
+$ ls
+84087 dqp
+227386 zprprf.gfs
+$ cd ..
+$ cd mwg
+$ ls
+214086 pflp.mdw
+dir sjjsdn
+225859 wcdt
+158892 zprprf.frs
+$ cd sjjsdn
+$ ls
+260121 gplgp.dfn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir hcrwclpg
+dir zphd
+$ cd hcrwclpg
+$ ls
+dir cmqntjj
+16393 ldzslndn.qbm
+91152 qqdtc.zdq
+$ cd cmqntjj
+$ ls
+272266 ldzslndn.pll
+$ cd ..
+$ cd ..
+$ cd zphd
+$ ls
+165711 chftwcsw.fqw
+256871 cvcl.jqh
+251168 zprprf.gfv
+$ cd ..
+$ cd ..
+$ cd msztjvcb
+$ ls
+206231 brzn.lmn
+dir dcqnblb
+21571 dqp
+dir fmn
+45779 mlfctz.cjr
+288827 pflp.mdw
+220578 qcq.fqf
+$ cd dcqnblb
+$ ls
+198121 ghbwgs
+93681 nmqhl.vpq
+$ cd ..
+$ cd fmn
+$ ls
+29407 mdfws.qvs
+$ cd ..
+$ cd ..
+$ cd sjzrcg
+$ ls
+155120 ddclvsjr.rpq
+136029 ldzslndn.dcm
+dir vhzh
+$ cd vhzh
+$ ls
+212446 vbn
+$ cd ..
+$ cd ..
+$ cd zprprf
+$ ls
+240335 crt.gqh
+185363 gnmm.qgh
+dir ldzslndn
+dir nwl
+dir qll
+277043 vbn
+217796 vtvgpdl.vtm
+$ cd ldzslndn
+$ ls
+273570 cvcl.jqh
+68510 fgdmz.hrc
+dir npq
+dir swjrzzrm
+$ cd npq
+$ ls
+97923 dzcjsqwt
+$ cd ..
+$ cd swjrzzrm
+$ ls
+180599 tmpgn.bjf
+$ cd ..
+$ cd ..
+$ cd nwl
+$ ls
+171833 dlwrfhh.qgn
+$ cd ..
+$ cd qll
+$ ls
+219926 dcqnblb.bvn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir lvpb
+276198 tbgcm.qct
+$ cd lvpb
+$ ls
+142590 bvhjlld
+268259 gnjfg.sgb
+dir qcq
+206220 qcq.zsg
+258137 rrsw.dnb
+dir tmr
+215549 vbn
+$ cd qcq
+$ ls
+dir mmpgd
+dir tdsz
+dir tmfvsjwc
+$ cd mmpgd
+$ ls
+70793 jwbnpwnn
+$ cd ..
+$ cd tdsz
+$ ls
+246310 tdvrhhg.bzq
+$ cd ..
+$ cd tmfvsjwc
+$ ls
+103899 grpdmd.ggz
+287850 ldzslndn
+125930 llhr
+$ cd ..
+$ cd ..
+$ cd tmr
+$ ls
+83344 fbtfcg.hqp
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir lbgmcbv
+dir nbg
+$ cd lbgmcbv
+$ ls
+81776 wzdzzdp
+$ cd ..
+$ cd nbg
+$ ls
+dir mfsgjp
+155574 pflp.mdw
+$ cd mfsgjp
+$ ls
+199400 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd nfspb
+$ ls
+262412 csrdtbs
+73867 vbn
+136389 zqps.hjt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd nhqwt
+$ ls
+123766 cvcl.jqh
+dir dhrtvctp
+222086 grpdmd.ggz
+dir gzg
+26005 lhpmz.tgz
+dir mcnjwwfr
+117122 msn.gst
+$ cd dhrtvctp
+$ ls
+224079 vdgcqdn.sqd
+$ cd ..
+$ cd gzg
+$ ls
+124395 dqp
+dir wqdbtqm
+$ cd wqdbtqm
+$ ls
+237354 pflp.mdw
+212019 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd mcnjwwfr
+$ ls
+92504 cshdztf
+dir dctl
+dir dqp
+dir flcrmhlj
+161879 grpdmd.ggz
+dir gtt
+dir hlbnhchz
+220093 mdtdsgvm.zgg
+dir twntr
+287192 vbn
+$ cd dctl
+$ ls
+dir bbhch
+155396 hrrj.jzm
+164971 pblqmwj.vdb
+dir wnlgfpvf
+$ cd bbhch
+$ ls
+dir dpqtp
+dir jvdrcw
+$ cd dpqtp
+$ ls
+174135 gwb.qrb
+$ cd ..
+$ cd jvdrcw
+$ ls
+215993 dcqnblb.cqp
+200800 stjttf.ngc
+$ cd ..
+$ cd ..
+$ cd wnlgfpvf
+$ ls
+135978 cvcl.jqh
+dir dqp
+54018 lbrfmt
+$ cd dqp
+$ ls
+270516 dcqnblb.jqw
+dir dqp
+144626 grpdmd.ggz
+157731 hvcv.rhp
+133773 lnnt
+76250 vdgcqdn.sqd
+$ cd dqp
+$ ls
+41504 zprprf.cmc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir dqp
+dir ldzslndn
+236737 mqzcvm.fjh
+239746 nhcdz.ncj
+dir rpchqq
+248824 vdgcqdn.sqd
+250937 zrchht.mwg
+$ cd dqp
+$ ls
+203381 qcq.djm
+$ cd ..
+$ cd ldzslndn
+$ ls
+dir dqp
+dir fptnzlv
+dir gmbnpm
+dir vhvblt
+$ cd dqp
+$ ls
+19579 qcq.lhg
+$ cd ..
+$ cd fptnzlv
+$ ls
+209930 dcqnblb
+$ cd ..
+$ cd gmbnpm
+$ ls
+dir ldzslndn
+dir qcq
+$ cd ldzslndn
+$ ls
+11075 pflp.mdw
+$ cd ..
+$ cd qcq
+$ ls
+dir tdp
+$ cd tdp
+$ ls
+40741 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd vhvblt
+$ ls
+dir lzr
+$ cd lzr
+$ ls
+62245 gbnj.llg
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd rpchqq
+$ ls
+dir bcs
+dir dcqnblb
+dir fvjzn
+dir lrphzrv
+$ cd bcs
+$ ls
+179794 bbn.dzb
+242069 cmjdmzjf.zgf
+1703 cvcl.jqh
+dir gnmhwj
+dir ldzslndn
+152520 qltpsz.jsj
+dir sqqjfps
+$ cd gnmhwj
+$ ls
+dir gvs
+201600 hptn.ftf
+dir hzrnb
+dir qcq
+dir sqhl
+$ cd gvs
+$ ls
+152358 zprprf.mlh
+$ cd ..
+$ cd hzrnb
+$ ls
+94290 gplsfd
+$ cd ..
+$ cd qcq
+$ ls
+91909 vmqd.bmg
+$ cd ..
+$ cd sqhl
+$ ls
+238673 vdgcqdn.sqd
+262885 zmdvr.nfg
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+240461 mdz
+84303 qtj
+$ cd ..
+$ cd sqqjfps
+$ ls
+88753 fwn.tff
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir dqp
+189996 dqp.pvp
+$ cd dqp
+$ ls
+dir qvfjz
+196506 vbn
+$ cd qvfjz
+$ ls
+209316 pflp.mdw
+107459 rwpbh.vpt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fvjzn
+$ ls
+241464 cvcl.jqh
+dir dqp
+dir ldzslndn
+dir msp
+125 pflp.mdw
+131895 vbn
+$ cd dqp
+$ ls
+34019 pflp.mdw
+202957 vbn
+$ cd ..
+$ cd ldzslndn
+$ ls
+147492 cvcl.jqh
+248719 spc.rfv
+$ cd ..
+$ cd msp
+$ ls
+184407 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd lrphzrv
+$ ls
+dir bbwqmbg
+81858 cvcl.jqh
+dir dqp
+248670 gqqsww.tsn
+199141 grpdmd.ggz
+dir ldzslndn
+34514 ldzslndn.ctw
+dir tln
+214615 zprprf.fwm
+$ cd bbwqmbg
+$ ls
+129750 flf
+dir pvlw
+dir qcq
+126 sqcqphz.tbm
+$ cd pvlw
+$ ls
+198005 jfvj.hdv
+$ cd ..
+$ cd qcq
+$ ls
+dir wgdzws
+$ cd wgdzws
+$ ls
+253522 ldzslndn.qwt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+281993 cvcl.jqh
+dir hwqjlwcb
+50532 msccz.qgm
+102187 trv.tnq
+111 wplnmj.bfl
+$ cd hwqjlwcb
+$ ls
+267580 dhjqb.dsb
+153195 ldzslndn.jqv
+41526 mvwcwc.zsc
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+58666 cvcl.jqh
+79950 dqp.tmc
+242217 hns.lrb
+dir njswzh
+240692 vdgcqdn.sqd
+dir zvmjvcdm
+52909 zzh
+$ cd njswzh
+$ ls
+149732 cvcl.jqh
+dir rnmfd
+$ cd rnmfd
+$ ls
+75368 dqp.hmv
+14350 vbn
+$ cd ..
+$ cd ..
+$ cd zvmjvcdm
+$ ls
+dir jgczt
+$ cd jgczt
+$ ls
+dir qcq
+95941 qzvvwshv.jwc
+$ cd qcq
+$ ls
+273942 pflp.mdw
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd tln
+$ ls
+dir bmcng
+1518 lrg
+dir vnjfrhp
+$ cd bmcng
+$ ls
+38917 fqcrt
+$ cd ..
+$ cd vnjfrhp
+$ ls
+dir dcqnblb
+dir dqp
+247186 grpdmd.ggz
+dir ldzslndn
+169216 pflp.mdw
+206487 vdgcqdn.sqd
+16976 vlsrzjmb.mmc
+257938 wjl
+$ cd dcqnblb
+$ ls
+dir dqp
+$ cd dqp
+$ ls
+184133 qcq
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir dcqnblb
+31612 dqp.pnt
+212283 ldzslndn
+61600 vdbfc.ddj
+197189 wpv.wff
+$ cd dcqnblb
+$ ls
+62412 tfzllmrj
+dir zprprf
+$ cd zprprf
+$ ls
+dir bqnpsl
+dir dszrvpzc
+$ cd bqnpsl
+$ ls
+261548 spbsbbsw.cmn
+$ cd ..
+$ cd dszrvpzc
+$ ls
+188232 sggpqslr.smn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+dir bgnhd
+dir pgvcdzwz
+dir qgzhm
+$ cd bgnhd
+$ ls
+56989 cvcl.jqh
+$ cd ..
+$ cd pgvcdzwz
+$ ls
+110034 qhgnndv
+$ cd ..
+$ cd qgzhm
+$ ls
+247232 grpdmd.ggz
+269292 ldzslndn
+153843 tpz
+dir vnschqwr
+162392 wnq.btb
+$ cd vnschqwr
+$ ls
+43005 fvtvzfqm.jvc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd flcrmhlj
+$ ls
+245668 dcqnblb.sdj
+dir lffj
+229909 pflp.mdw
+280176 vbn
+$ cd lffj
+$ ls
+116451 jmzz.jdd
+dir pjlwb
+162815 pmhlqq.snr
+226183 zffth
+$ cd pjlwb
+$ ls
+67518 qcq.hjq
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd gtt
+$ ls
+52105 grpdmd.ggz
+126869 zprprf.fgj
+$ cd ..
+$ cd hlbnhchz
+$ ls
+3064 dqp.lrw
+278756 grpdmd.ggz
+177208 ldzslndn.wlv
+141685 vbn
+$ cd ..
+$ cd twntr
+$ ls
+63747 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+226858 cwblp.zgp
+dir jjqsmfhr
+dir rjbqtrq
+dir vwmpnbts
+141715 wdbhdch
+286381 zprprf
+$ cd jjqsmfhr
+$ ls
+dir btmm
+dir fqndtlgq
+$ cd btmm
+$ ls
+4031 dqp.lrr
+dir fzdd
+$ cd fzdd
+$ ls
+dir vnwpn
+$ cd vnwpn
+$ ls
+dir bzlgsl
+dir ztvzrrbv
+$ cd bzlgsl
+$ ls
+9294 ldzslndn.sqr
+$ cd ..
+$ cd ztvzrrbv
+$ ls
+256017 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fqndtlgq
+$ ls
+271528 ccbmgp.bwd
+$ cd ..
+$ cd ..
+$ cd rjbqtrq
+$ ls
+122150 ldzslndn
+46467 tpdvp.pjf
+$ cd ..
+$ cd vwmpnbts
+$ ls
+47518 fcrwfzvm
+263343 gmc.lrt
+212764 qcq
+$ cd ..
+$ cd ..
+$ cd vwqwlqrt
+$ ls
+dir psrs
+$ cd psrs
+$ ls
+281998 zprprf.hml

2022/inputs/08.txt

@@ -0,0 +1,99 @@
+133120320210233440424211425033311533112110111336536142004454550513525522325223123404213204010312200
+201131111014211324423255354022022243226445013613610423653614522135534505055120330313403031333103010
+312033232323231244025301315245341424106564334260061464515142114141551050411122254121204214442432210
+101223224313414001513045124413405604251532415616200623342234245060512030200002055453441222043022132
+302000022010423415300513533001221654231646352603366222420353100303160621313144421120541324031322221
+022041343104313414435021243154525050055065506466215004364316065443031303052541012204020300331224312
+103341401201343234101335152026143021665443260024145323023321363412215203352344024010350241320230403
+113420142141151035404302242616255522460104100534576523546245441245051223305614204355454223220120301
+141313120334140413444311032422155464031057323373712672513175353623531154646460010504312302300002224
+222122233241135333145102102244620325637577115357373355166254434732406430504542404102101335430322111
+303334221050505214133200215501142243567431213624743475716112467711442460620524310041114411011423020
+314200333004550151023253063621162447552734266222424315622125733562141045411643325165010440012411104
+002041023423222500521530364652321342767176666734452465675417573276212213343035032650010252311440041
+424112310115314154624123026322722176144615437667237551164455332134452657635041110204303331153310423
+403331525242111322464321027125164326531546671615634451453753666614652523355664316050035035431040223
+043240150545010061116502263626227235517673287377662722735257631252161774623714640414211242003124031
+120153432445266666010553121747235535567222344854553227754373283562766712275433030145041514430322020
+130205252451225625553367153422361135376345652238658565468884466665635712475577163231554521534443142
+111112125502543266131422234726554665525278247588365447865236325776254766323137341434403365242323513
+303144132003506154604725457356146262354554756268227328243768455722852644644163423635454133132303535
+355321430425362320027571672735837582654822875282477453446323242873743335342262324741355251635040132
+134315335666154514547724226424352647855667536237263286847676436882327536177762242121655513144251300
+540433012152253201644772517187257277883368828477658659796427367852347254442546347411045431414354124
+123440236041532033152645165666552487887293658447738333978367787858534683322123676621510536503333401
+513523462114216537146475772264724378429935336847846348444575554346687726237537112655265045664650022
+152254463440132245722174776775434287876777476649865634494799993998688326736773121545343121065304241
+250224151321236513227671833576566739347663376834388478944395578563955424353347453672417622666244155
+515223301360505722213752783545553644495694566664938776366634393433784855746658113613537562051065554
+554241245610333147211334537367835857366454575934899676895788946595666473766285253431355325406031452
+100314521636253352672223432738853968767459797559486648888395749643933624738538781345525612342532041
+341462234622615555235573736647638675877393747847457878744844899855446378852378466172227414636330202
+345125124225634624432677378235488673587578945954767695474694483979633396738646725252521775306550112
+413420352557414334236458423883348897736674897485778466695756868398399557654674634472471146623221025
+251143521254271126368347667353953675589776644454498798849645686658369675764886773874127564444411365
+221413142252611772737673846553885549867478965666795885777985495763559573589863845361134756354652555
+243065641366675316826485533843887969469458797465896675796454946875597936434758642384462157714462066
+520553502161266638252882759578566955579648578498775589886979787578896857766344736358531725733564135
+424035430516117723442423478595343855468789497988556567558494878666699996375768427758374271236421335
+252313015177661777278432468494855844559656687766987679695575558744879656544795683583262246546564621
+066230444571526644743382974447835556985988567697575656976987588986595376466888728567376162756500435
+466346066733165454546438886894789699679455689766757985688888664759568963398874674733715475614334101
+325014552177542688745486585579599747867559596676796865787567755944786444539663262282351475561402534
+241163303516225237353826934978454869995779765759887659668665685578986859343646684568651136735352562
+450361264326612736655359595445797648876877955597997887987765775498545883744548752574473726565411112
+554605215356217343577344399893857478777797855566878769757669857854854856357865565536552164136515351
+526446641376374684266375494495458695869978975788699978669887967564769488567376982882762633361324360
+131314671231526545866684867949989786895865986986978678997899677764988874736369482822342624761635224
+623254034413371684428636874768586849979569867987768799666579796798469744978968758623884477174221325
+451620621666445477562568544366499474968796999686779676678989576768596484478933764745243527321126622
+454130052341168772645439448775675586969558878998779766779998798589986885955369648636673756137543515
+052463667567627485865289577459895546659595768687867979887989666587865576357344373227477771625616331
+460630633631764266522893997758984967975685969969798677679989558694657986684466928784764257141450213
+624130637644652532575536775488944945689777797679988979876565896659695947897698966634635115577122034
+312106635521463635433584476586795448766769568869779667989675669974989668369378542526764316562641343
+162151455625714643563689555468449898859656786796979798687579985864586658783373657585741615177725655
+522113305657225658843435489885646557577988797667968888669868768989959977879557377455733555272325032
+304510566333111422674633384687874565587979787768979689685867565897484896499888736286384551117254613
+501463041455354857783745556844585568845776985978966685877875599798784456633539465754543114144204310
+033044042511137887672349889484876755578886688778959586777755687684946795536886522746575472552603266
+506221035322726455557224463853355996897775558969955685797667999588974556935495475632746634441041151
+433136161743725565262636565676447685475989796568778598958657768879849778786859753335661722543205305
+265454361556653132263478888989675487694888975877759959776785674478666588788563747772733262666414514
+052441631644734262283652379957577654769979687765967795697668686969788694345962866843241632716655446
+236003436545632166356247457495793686988694668988898785686844466844799668333966735544674562633412352
+521460600027621624875854349394389587767654998655578976768847769685597639387383648267451531624063352
+342222114334344716267243334967869638699594976567878976765649455495834476654882454551336614731204621
+033566313156263553885434364795389663465876465857797479766958478858465479967473865454116236530266023
+312652012603144155543338267594667756579949844587785799854455597889659839838335338227724422251205254
+300006533237512225736566526838475448787546947968579975977675656694697397732838257677271224106345603
+133143326544516157647526755363599347754745759889457964588954897669586537634253625642342472416641244
+154255220262671713413357272553997888597745494647794956965689397737688378433337485552276212554465555
+100240040401314462336283253854484757937369955476776566463546476496874852334852883176722554655020500
+114224164252562264455188387248845988369836588899857935337746669656565572827235667727764740332042104
+210035410165643165676172383567428973379998596753776399638478657839665546428878531777515004325230423
+210124643010215635561443542385838474565467799589387569934754637575772733563765332372676641151131504
+302221012422133674231332744234367852633548864367379437949776375866557752335873376756770315423300102
+332125266633066263556242566636554222886478446383395355568773939525563625678526672212234343222625410
+025325451166410144267526457225543863563576656495967865696633785745578788783545643421165350000423343
+002055431510265615765734547166486528454663847694453963495886284323368575223225414276066312104153401
+355245141260142612771253626632378444477523462347872628387736452238277834561572523626005254261254042
+203545210065351052363237141625823577635472367448676276452678742864237273162112414622640501555430121
+335510044411666505051763342712375473385677658477545568853568734655885763312211631300144242225254322
+420503535251235101224431771412136627846753333256668624663675776462422374227471570160056336045543305
+311442220344522144201454355125161416822475756464544562823568565277363143626236634605524051151344323
+221042430004563020306242752654674353744234455564453257548654537765566764222366445225313642034222311
+410315020300414623613025143245525766347157877736466252545465214236744364172443246502214503112203230
+342304354225251006345461616171626576425171512572743837515273314522745717111151266035240243530314400
+101402542354002125435251304674647534521162334775342133371111747561164265140621412560624450505304430
+011211315525203435452400223603127166746242764515517634515312173434163762164444142306041434112503201
+312201041521122523410120106532007714457744313215145447526753371116262403622123305243410143403304001
+420143230433241404304622552610552657576751252637557577175144676122663421114064036341501055504120312
+321114124142324224151525015553652243236362311234247651266113535462142056365353412114023231401141232
+144010233331150422332523034411415500511027722375253755262514425243333354512150011301540445044301243
+321223141143321313415515024451144622413543514327723454716501265226013550620005111202312303242203422
+220312222242043544521300416060642531526303363025212311016020154415132623214322110011054242222314401
+120043213410140522500232142235034335033562221102412305131143065020436150033340525535242031300403012
+333011210021031104353104420453564321600565055235040060414452305642301521213234000231332120021102311
+213000422032423433105500120521112552552162045443040565055142555024614151234210022135411312102303010
+311113213314300134505043355233124354500023350433035532626242646113034040102425400244311432332422101

2022/src/common.rs

@@ -1,6 +1,7 @@
 //! Common helper utilities to all days
 
 use anyhow::Result;
+use nom::combinator::map;
 use nom::error::ErrorKind;
 use nom::error::ParseError;
 use nom::Finish;
@@ -93,6 +94,17 @@ where
     }
 }
 
+/// Add an index to repeated successful invocations of the embedded parser.
+pub fn enumerate<I, O, E>(f: impl Parser<I, O, E>) -> impl FnMut(I) -> IResult<I, (usize, O), E> {
+    let mut index = 0usize;
+
+    map(f, move |v| {
+        let res = (index, v);
+        index += 1;
+        res
+    })
+}
+
 /// Return the minimum and maximum of two unordered variables
 pub fn minmax<T>(a: T, b: T) -> (T, T)
 where

2022/src/day05.rs

@@ -1,9 +1,166 @@
+use std::cmp::Ordering;
+
 use anyhow::Result;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take;
+use nom::bytes::complete::take_until;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::combinator::opt;
+use nom::multi::fold_many1;
+use nom::multi::many1;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
 
-pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+use crate::common::enumerate;
+use crate::common::parse_input;
+
+type Move = (usize, usize, usize);
+type OwnedStacks = Vec<Vec<u8>>;
+
+fn parse_row<'a>(input: &'a [u8], stacks: &mut OwnedStacks) -> IResult<&'a [u8], ()> {
+    // Forgive me for this crime
+    fold_many1(
+        enumerate(terminated(
+            alt((
+                // Parse a delimited value into a Some(content)
+                map(delimited(tag("["), take(1usize), tag("]")), |v: &[u8]| {
+                    Some(v[0])
+                }),
+                // Or an empty stack into a None
+                map(tag("   "), |_| None),
+            )),
+            opt(tag(" ")),
+        )),
+        || (),
+        move |_, (index, c)| {
+            if let Some(b) = c {
+                if stacks.len() <= index {
+                    stacks.resize_with(index + 1, Vec::new);
+                }
+
+                stacks[index].push(b)
+            }
+        },
+    )(input)
 }
 
-pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+fn parse_stacks(input: &[u8]) -> IResult<&[u8], OwnedStacks> {
+    let mut stacks = Vec::new();
+
+    let (input, _) = terminated(
+        fold_many1(
+            terminated(|input| parse_row(input, &mut stacks), newline),
+            || (),
+            |_, _| (),
+        ),
+        // Skip the line with the numbers
+        take_until("\n\n"),
+    )(input)?;
+
+    // Reverse the stacks since we parsed them top-down
+    for stack in &mut stacks {
+        stack.reverse();
+    }
+
+    Ok((input, stacks))
+}
+
+fn parse_task(input: &[u8]) -> IResult<&[u8], (OwnedStacks, Vec<Move>)> {
+    fn parse_usize(input: &[u8]) -> IResult<&[u8], usize> {
+        map(nom::character::complete::u32, |v| v as usize)(input)
+    }
+    let (input, stacks) = parse_stacks(input)?;
+
+    // Consume the double newline
+    let (input, _) = tag("\n\n")(input)?;
+
+    let (input, moves) = many1(terminated(
+        tuple((
+            preceded(tag("move "), parse_usize),
+            preceded(tag(" from "), parse_usize),
+            preceded(tag(" to "), parse_usize),
+        )),
+        newline,
+    ))(input)?;
+
+    Ok((input, (stacks, moves)))
+}
+
+/// Some magic to get two mutable references into the same slice
+fn get_both(stacks: &mut [Vec<u8>], from: usize, to: usize) -> (&mut Vec<u8>, &mut Vec<u8>) {
+    match from.cmp(&to) {
+        Ordering::Greater => {
+            let (begin, end) = stacks.split_at_mut(from);
+            (&mut end[0], &mut begin[to])
+        }
+        Ordering::Less => {
+            let (begin, end) = stacks.split_at_mut(to);
+            (&mut begin[from], &mut end[0])
+        }
+        Ordering::Equal => panic!("Tried to stack from and to {from}"),
+    }
+}
+
+fn compute_answer(stacks: &mut [Vec<u8>]) -> Result<String> {
+    let mut result = String::with_capacity(stacks.len());
+
+    for stack in stacks {
+        result.push(
+            *stack
+                .last()
+                .ok_or_else(|| anyhow::anyhow!("Encountered empty stack"))? as char,
+        );
+    }
+
+    Ok(result)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let (mut stacks, moves) = parse_input(input, parse_task)?;
+
+    for (count, from, to) in moves {
+        let (from, to) = get_both(&mut stacks, from - 1, to - 1);
+
+        let drain_start = from.len() - count;
+
+        to.extend(from.drain(drain_start..).rev());
+    }
+
+    compute_answer(&mut stacks)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let (mut stacks, moves) = parse_input(input, parse_task)?;
+
+    for (count, from, to) in moves {
+        let (from, to) = get_both(&mut stacks, from - 1, to - 1);
+
+        let drain_start = from.len() - count;
+
+        to.extend(from.drain(drain_start..));
+    }
+
+    compute_answer(&mut stacks)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/05.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "CMZ");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "MCD");
+    }
 }

2022/src/day06.rs

@@ -1,9 +1,68 @@
 use anyhow::Result;
 
-pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+fn find_first(input: &[u8], unique: usize) -> Result<usize> {
+    let mut seen = [false; 256];
+
+    let mut tail_it = input.iter();
+
+    let mut first = 0;
+
+    // Loop invariant: input[first..last] contains only unique characters
+    for (last, &c) in input.iter().enumerate() {
+        if seen[c as usize] {
+            first += (&mut tail_it)
+                .take_while(|&&b| b != c)
+                .map(|&b| seen[b as usize] = false)
+                .count()
+                + 1; // +1 because take_while doesn't return the first element that didn't satisfy the condition, while we do need to count it
+        } else {
+            // New unique character found: input[first..=last] contains unique characters
+            if last - first + 1 == unique {
+                return Ok(last + 1);
+            }
+
+            seen[c as usize] = true;
+        }
+    }
+
+    anyhow::bail!("Did not find unique sequence of length {unique}");
 }
 
-pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+pub fn part1(input: &[u8]) -> Result<String> {
+    Ok(find_first(input, 4)?.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    Ok(find_first(input, 14)?.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLES: &[&[u8]] = &[
+        b"mjqjpqmgbljsphdztnvjfqwrcgsmlb",
+        b"bvwbjplbgvbhsrlpgdmjqwftvncz",
+        b"nppdvjthqldpwncqszvftbrmjlhg",
+        b"nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg",
+        b"zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw",
+    ];
+
+    #[test]
+    fn sample_part1() {
+        const CORRECT: &[usize] = &[7, 5, 6, 10, 11];
+
+        for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
+            assert_eq!(find_first(sample, 4).unwrap(), correct);
+        }
+    }
+
+    #[test]
+    fn sample_part2() {
+        const CORRECT: &[usize] = &[19, 23, 23, 29, 26];
+
+        for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
+            assert_eq!(find_first(sample, 14).unwrap(), correct);
+        }
+    }
 }

2022/src/day07.rs

@@ -1,9 +1,124 @@
+use anyhow::Context;
 use anyhow::Result;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take_until;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::combinator::opt;
+use nom::multi::fold_many0;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
 
-pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+use crate::common::parse_input;
+
+fn parse_dir<'a>(
+    input: &'a [u8],
+    dirs: &mut Vec<u32>,
+    dir_stack: &mut Vec<&'a [u8]>,
+) -> IResult<&'a [u8], u32> {
+    use nom::character::complete::u32;
+
+    enum Entry<'a> {
+        File(u32),
+        Dir(&'a [u8]),
+    }
+    let initial_len = dir_stack.len();
+
+    let (mut input, mut size) = preceded(
+        tag("$ ls\n"),
+        fold_many0(
+            // Map many newline-terminated entries
+            terminated(
+                // of either
+                alt((
+                    // A size followed by a name
+                    map(terminated(u32, take_until("\n")), Entry::File),
+                    // Or the word "dir" followed by a name
+                    map(preceded(tag("dir "), take_until("\n")), Entry::Dir),
+                )),
+                newline,
+            ),
+            || 0u32,
+            |files_sum, entry| match entry {
+                Entry::File(size) => files_sum + size,
+                Entry::Dir(name) => {
+                    dir_stack.push(name);
+                    files_sum
+                }
+            },
+        ),
+    )(input)?;
+
+    for i in initial_len..dir_stack.len() {
+        let (new_input, content_size) = delimited(
+            tuple((tag("$ cd "), tag(dir_stack[i]), newline)),
+            |input| parse_dir(input, dirs, dir_stack),
+            // Optional cd'ing out because the last directory is never exited.
+            opt(tag("$ cd ..\n")),
+        )(input)?;
+
+        input = new_input;
+        size += content_size;
+    }
+
+    dirs.push(size);
+    dir_stack.truncate(initial_len);
+
+    Ok((input, size))
 }
 
-pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+fn parse_program(input: &[u8]) -> IResult<&[u8], (u32, Vec<u32>)> {
+    let mut dirs = Vec::new();
+    let mut dirstack = Vec::new();
+    let (input, size) = preceded(tag("$ cd /\n"), |input| {
+        parse_dir(input, &mut dirs, &mut dirstack)
+    })(input)?;
+
+    Ok((input, (size, dirs)))
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let (_, sizes) = parse_input(input, parse_program)?;
+
+    let searched_size: u32 = sizes.into_iter().filter(|&size| size <= 100000).sum();
+
+    Ok(searched_size.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    const TARGET: u32 = 30000000;
+    const TOTAL: u32 = 70000000;
+
+    let (used, sizes) = parse_input(input, parse_program)?;
+
+    let required = TARGET - (TOTAL - used);
+
+    let min = sizes
+        .into_iter()
+        .filter(|&size| size >= required)
+        .min()
+        .context("Did not find dir large enough to delete")?;
+
+    Ok(min.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/07.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "95437");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "24933642");
+    }
 }

2022/src/day08.rs

@@ -1,9 +1,163 @@
+use std::cmp::Ordering;
+
+use anyhow::Context;
 use anyhow::Result;
 
-pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+#[inline]
+fn stripe<'a>(
+    values: impl IntoIterator<Item = &'a u8>,
+    visible: impl IntoIterator<Item = &'a mut bool>,
+) {
+    let mut max = 0;
+
+    for (&val, visible) in values.into_iter().zip(visible) {
+        if val > max {
+            max = val;
+            *visible = true;
+
+            if val == b'9' {
+                return;
+            }
+        }
+    }
 }
 
-pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+pub fn part1(input: &[u8]) -> Result<String> {
+    let width = input
+        .iter()
+        .position(|&b| b == b'\n')
+        .context("Single row field")?;
+    let height = input.len() / (width + 1); // Include newlines
+
+    let mut visible = vec![false; width * height];
+
+    // Horizontal striping
+    for (y, row) in input.chunks_exact(width + 1).enumerate() {
+        // First, left to right
+        stripe(&row[..width], &mut visible[(y * width)..]);
+
+        // Then right to left
+        stripe(
+            row[..width].iter().rev(),
+            visible[(y * width)..(y * width + width)].iter_mut().rev(),
+        );
+    }
+
+    // Vertical striping
+    for x in 0..width {
+        // Top to bottom
+        stripe(
+            input[x..].iter().step_by(width + 1),
+            visible[x..].iter_mut().step_by(width),
+        );
+
+        // Bottom to top
+        stripe(
+            input[x..].iter().step_by(width + 1).rev(),
+            visible[x..].iter_mut().step_by(width).rev(),
+        )
+    }
+
+    Ok(visible.into_iter().filter(|&b| b).count().to_string())
+}
+
+#[inline]
+fn scenery<'a>(
+    values: impl IntoIterator<Item = &'a u8>,
+    visible: impl IntoIterator<Item = &'a mut usize>,
+    tree_stack: &mut Vec<(usize, u8)>,
+) {
+    tree_stack.clear();
+
+    for (i, (&val, score)) in values.into_iter().zip(visible).enumerate() {
+        scenery_helper(i, tree_stack, val, score);
+    }
+}
+
+fn scenery_helper(i: usize, tree_stack: &mut Vec<(usize, u8)>, val: u8, score: &mut usize) {
+    if i > 0 {
+        let mut first = 0;
+
+        while let Some((pos, other)) = tree_stack.pop() {
+            match other.cmp(&val) {
+                Ordering::Less => (),
+                Ordering::Equal => {
+                    first = pos;
+                    break;
+                }
+                Ordering::Greater => {
+                    tree_stack.push((pos, other));
+                    first = pos;
+                    break;
+                }
+            }
+        }
+
+        tree_stack.push((i, val));
+
+        *score *= i - first;
+    } else {
+        *score = 0;
+    }
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let width = input
+        .iter()
+        .position(|&b| b == b'\n')
+        .context("Single row field")?;
+    let height = input.len() / (width + 1); // Include newlines
+
+    let mut score = vec![1; width * height];
+
+    let mut tree_stack = Vec::with_capacity(10);
+
+    // Horizontal striping
+    for (y, row) in input.chunks_exact(width + 1).enumerate() {
+        // First, left to right
+        scenery(&row[..width], &mut score[(y * width)..], &mut tree_stack);
+
+        // Then right to left
+        scenery(
+            row[..width].iter().rev(),
+            score[(y * width)..(y * width + width)].iter_mut().rev(),
+            &mut tree_stack,
+        );
+    }
+
+    // Vertical striping
+    for x in 0..width {
+        // Top to bottom
+        scenery(
+            input[x..].iter().step_by(width + 1),
+            score[x..].iter_mut().step_by(width),
+            &mut tree_stack,
+        );
+
+        // Bottom to top
+        scenery(
+            input[x..].iter().step_by(width + 1).rev(),
+            score[x..].iter_mut().step_by(width).rev(),
+            &mut tree_stack,
+        )
+    }
+
+    Ok(score.into_iter().max().context("empty field")?.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/08.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "21");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "8");
+    }
 }

2022/src/day09.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day10.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day11.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day12.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day13.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day14.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day15.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day16.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day17.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day18.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day19.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day20.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day21.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day22.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day23.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day24.rs

@@ -1,9 +1,9 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }
 
 pub fn part2(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/day25.rs

@@ -1,5 +1,5 @@
 use anyhow::Result;
 
 pub fn part1(_input: &[u8]) -> Result<String> {
-    todo!()
+    anyhow::bail!("not implemented")
 }

2022/src/samples/05.txt

@@ -0,0 +1,9 @@
+    [D]    
+[N] [C]    
+[Z] [M] [P]
+ 1   2   3 
+
+move 1 from 2 to 1
+move 3 from 1 to 3
+move 2 from 2 to 1
+move 1 from 1 to 2

2022/src/samples/07.txt

@@ -0,0 +1,23 @@
+$ cd /
+$ ls
+dir a
+14848514 b.txt
+8504156 c.dat
+dir d
+$ cd a
+$ ls
+dir e
+29116 f
+2557 g
+62596 h.lst
+$ cd e
+$ ls
+584 i
+$ cd ..
+$ cd ..
+$ cd d
+$ ls
+4060174 j
+8033020 d.log
+5626152 d.ext
+7214296 k

2022/src/samples/08.txt

@@ -0,0 +1,5 @@
+30373
+25512
+65332
+33549
+35390