Slightly better ICACHE hits

230 byte overhead is worth it to avoid conversions and potential
indexing errors

.github/workflows/2022.yml

@@ -1,7 +1,7 @@
 on:
   - push
 
-name: Advent of Code 2021
+name: Advent of Code 2022
 
 jobs:
   ci:
@@ -20,7 +20,7 @@ jobs:
     continue-on-error: ${{ matrix.experimental }}
 
     steps:
-      - uses: actions/checkout@v2
+      - uses: actions/checkout@v3
 
       - name: Install toolchain
         uses: actions-rs/toolchain@v1
@@ -30,17 +30,23 @@ jobs:
           override: true
           components: rustfmt, clippy
 
+      - name: Set up caching
+        uses: Swatinem/rust-cache@v2
+        with:
+          workspaces: >
+            2022 -> target
+
       - name: Build binaries
-        working-directory: 2021
+        working-directory: 2022
         run: >
           cargo build --all-targets
 
       - name: Run tests
-        working-directory: 2021
+        working-directory: 2022
         run: >
           cargo test
 
       - name: Run clippy
-        working-directory: 2021
+        working-directory: 2022
         run: >
           cargo clippy -- --deny warnings

2016/day-04/Cargo.toml

@@ -4,4 +4,4 @@ version = "0.1.0"
 authors = ["Bert Peters <bert.ljpeters@gmail.com>"]
 
 [dependencies]
-regex = "0.1"
+regex = "1"

2016/day-04/src/main.rs

@@ -73,10 +73,10 @@ fn main() {
         let door_label = line.unwrap();
         let caps = room_pattern.captures(&door_label).unwrap();
 
-        let name = caps.at(1).unwrap();
-        let checksum = caps.at(4).unwrap();
+        let name = caps.get(1).unwrap().as_str();
+        let checksum = caps.get(4).unwrap().as_str();
         if is_valid(name, checksum) {
-            let sector_id = caps.at(3).unwrap().parse().unwrap();
+            let sector_id = caps.get(3).unwrap().as_str().parse().unwrap();
             cur_sum += sector_id;
 
             let decoded: String = name.chars()

2016/day-09/Cargo.toml

@@ -4,5 +4,5 @@ version = "0.1.0"
 authors = ["Bert Peters <bert.ljpeters@gmail.com>"]
 
 [dependencies]
-regex = "^0.1"
-lazy_static = "^0.2"
+regex = "1"
+lazy_static = "1"

2016/day-10/Cargo.toml

@@ -4,4 +4,4 @@ version = "0.1.0"
 authors = ["Bert Peters <bert.ljpeters@gmail.com>"]
 
 [dependencies]
-regex="^0.1"
+regex="1"

2021/Cargo.toml

@@ -5,10 +5,21 @@ edition = "2021"
 
 
 [dependencies]
-clap = { version = "3.0.0-rc.0", features = ["derive"] }
+clap = { version = "3", features = ["derive"] }
 itertools = "0.10"
 nom = "7"
 
+[dev-dependencies]
+criterion = "0.3"
+
 [profile.release]
 # Keep debug information in release for better flamegraphs
 debug = true
+
+[profile.bench]
+# And same for benchmarking
+debug = true
+
+[[bench]]
+name = "days"
+harness = false

2021/README.md

@@ -20,3 +20,15 @@ OPTIONS:
     -i, --input <INPUT>    Read input from the given file instead of stdin
     -t, --time             Print time taken
 ```
+
+## That goal was achieved
+
+Runtime benchmarked with [Criterion], reading input directly from memory to avoid disk IO
+inconsistencies.
+
+![Cumulative time](./cumulative-time.svg)
+
+![Time by day](./individual-time.svg)
+
+
+[Criterion]: https://github.com/bheisler/criterion.rs

2021/benches/days.rs

@@ -0,0 +1,45 @@
+use std::fs::File;
+use std::io::Read;
+
+use aoc_2021::get_implementation;
+use criterion::criterion_group;
+use criterion::criterion_main;
+use criterion::BenchmarkId;
+use criterion::Criterion;
+
+const DAYS_IMPLEMENTED: usize = 25;
+
+fn read_input(day: usize) -> Vec<u8> {
+    let input_path = format!("inputs/{:02}.txt", day);
+
+    let mut buffer = Vec::new();
+    File::open(input_path)
+        .expect("Failed to open input file")
+        .read_to_end(&mut buffer)
+        .expect("Failed to read input file");
+
+    buffer
+}
+
+pub fn benchmark_days(c: &mut Criterion) {
+    for day in 1..=DAYS_IMPLEMENTED {
+        let input = read_input(day);
+
+        let part1 = get_implementation(day, false);
+
+        c.bench_with_input(BenchmarkId::new("part1", day), &input, |b, i| {
+            b.iter(|| part1(&mut &i[..]));
+        });
+
+        if day < 25 {
+            let part2 = get_implementation(day, true);
+
+            c.bench_with_input(BenchmarkId::new("part2", day), &input, |b, i| {
+                b.iter(|| part2(&mut &i[..]));
+            });
+        }
+    }
+}
+
+criterion_group!(benches, benchmark_days);
+criterion_main!(benches);

2021/create_timing_plots.py

@@ -0,0 +1,97 @@
+#!/usr/bin/env python3
+import json
+from pathlib import Path
+from typing import Dict
+
+import numpy as np
+import matplotlib.pyplot as plt
+
+
+def read_timings() -> Dict[int, Dict]:
+    timings = {}
+
+    for day in Path('target/criterion/part1').iterdir():
+        with open(day / 'new' / 'estimates.json', mode='rb') as f:
+            timings[int(day.parts[-1])] = {
+                1: json.load(f)
+            }
+
+    for day in Path('target/criterion/part2').iterdir():
+        with open(day / 'new' / 'estimates.json', mode='rb') as f:
+            timings[int(day.parts[-1])][2] = json.load(f)
+
+    return timings
+
+
+def plot_cumulative_time(timings: Dict[int, Dict]):
+    plt.clf()
+
+    times = [0]
+
+    for day in range(min(timings.keys()), max(timings.keys()) + 1):
+        times.append(timings[day][1]['mean']['point_estimate'])
+        if day < 25:
+            times.append(timings[day][2]['mean']['point_estimate'])
+        else:
+            times.append(0)
+
+    cumulative = np.cumsum(times)
+    # Convert from nanoseconds to seconds
+    cumulative /= 1e9
+
+    x = np.arange(0.0, 25.5, 0.5)
+
+    plt.plot(x, cumulative, label="Cumulative time", drawstyle='steps-post')
+    plt.plot([0, 25], [0, 0.5], label="Target time")
+    plt.ylabel('Cumulative time (s)')
+    plt.xlabel('Days completed')
+
+    plt.legend()
+    plt.tight_layout()
+
+    plt.xlim(0, 25)
+    plt.ylim(0, 0.5)
+
+    plt.savefig('cumulative-time.svg')
+
+
+def plot_individual_times(timings: Dict[int, Dict]):
+    plt.clf()
+
+    def plot(parts, **kwargs):
+        x = np.arange(1, len(parts) + 1)
+
+        values = np.array(list(part['mean']['point_estimate'] for part in parts))
+        upper = np.array(list(part['mean']['confidence_interval']['upper_bound'] for part in parts))
+        lower = np.array(list(part['mean']['confidence_interval']['lower_bound'] for part in parts))
+
+        # Convert from ns to s
+        yerr = np.array([upper - values, lower - values]) / 1e9
+        values = values / 1e9
+
+        plt.bar(x, values, yerr=yerr, align='edge', log=True, **kwargs)
+        pass
+
+    plot(list(timings[day][1] for day in range(1, 26)), label="Part 1", width=-0.4)
+    plot(list(timings[day][2] for day in range(1, 25)), label="Part 2", width=0.4)
+
+    plt.ylabel('Runtime (s)')
+    plt.xlabel('Day')
+
+    plt.xlim(0, 26)
+    plt.xticks(np.arange(1, 26))
+
+    plt.legend()
+    plt.tight_layout()
+
+    plt.savefig('individual-time.svg')
+
+
+def main():
+    timings = read_timings()
+    plot_cumulative_time(timings)
+    plot_individual_times(timings)
+
+
+if __name__ == '__main__':
+    main()

2021/inputs/13.txt

@@ -0,0 +1,894 @@
+899,112
+477,249
+462,60
+49,299
+1097,819
+890,74
+477,231
+1242,464
+57,641
+833,471
+1292,784
+1232,717
+898,227
+442,749
+893,116
+395,423
+1304,695
+211,186
+1097,243
+1004,46
+654,361
+1044,784
+745,284
+376,637
+634,737
+509,369
+242,395
+199,442
+397,170
+634,94
+954,15
+1019,219
+798,782
+340,262
+1299,598
+1133,23
+967,5
+291,675
+519,119
+97,698
+291,107
+301,592
+505,537
+1280,780
+340,632
+919,588
+733,884
+166,577
+530,840
+1197,187
+1004,605
+244,668
+38,368
+1241,170
+1161,199
+597,701
+594,140
+1161,691
+505,357
+666,381
+947,107
+1268,179
+984,585
+418,775
+805,471
+1074,455
+142,245
+284,403
+1064,557
+207,766
+485,759
+236,775
+38,309
+329,59
+1169,857
+791,775
+1310,809
+530,715
+571,401
+525,673
+1064,701
+304,110
+402,350
+1237,172
+646,287
+959,156
+62,320
+674,364
+959,738
+723,535
+177,423
+798,85
+497,859
+825,99
+473,593
+575,45
+505,215
+764,133
+109,684
+884,457
+356,879
+920,238
+310,233
+79,266
+177,663
+691,868
+1290,352
+714,745
+493,527
+1173,65
+1026,520
+284,473
+662,647
+557,522
+1190,667
+181,180
+1178,114
+990,3
+798,649
+428,224
+428,511
+254,567
+574,669
+468,672
+324,801
+1290,542
+120,702
+271,312
+145,817
+1082,187
+1014,493
+691,420
+718,544
+412,560
+420,368
+428,432
+326,585
+686,108
+1297,25
+1290,782
+689,893
+1046,798
+194,588
+423,873
+97,876
+748,634
+865,887
+296,493
+1046,350
+488,311
+1048,411
+344,152
+962,718
+410,893
+986,801
+527,274
+798,654
+736,107
+462,95
+999,826
+1119,595
+604,652
+261,124
+20,352
+581,50
+417,778
+820,260
+310,651
+95,21
+20,21
+629,32
+1133,471
+1082,885
+82,450
+1079,0
+798,334
+420,634
+1243,87
+290,262
+477,295
+226,511
+915,670
+364,632
+248,625
+1062,269
+331,324
+713,193
+739,65
+74,667
+1248,574
+903,490
+65,868
+1250,306
+149,695
+574,673
+246,787
+570,717
+1225,105
+214,36
+904,336
+991,726
+1054,661
+744,765
+324,353
+73,546
+667,150
+780,179
+1136,381
+920,14
+57,253
+825,404
+638,427
+170,297
+231,465
+792,140
+979,773
+669,8
+1216,10
+1020,262
+758,158
+879,516
+621,893
+1183,172
+370,25
+140,446
+1034,820
+301,289
+325,835
+167,794
+1293,304
+58,521
+108,504
+718,96
+621,393
+890,816
+977,180
+236,887
+1277,309
+197,53
+999,397
+1133,599
+619,26
+932,746
+842,149
+1236,765
+16,651
+1216,688
+1149,367
+743,819
+706,674
+1212,259
+130,623
+273,54
+284,25
+284,491
+485,411
+313,248
+79,406
+1046,96
+13,663
+35,710
+306,166
+560,206
+1168,245
+460,101
+363,362
+505,19
+1248,47
+264,432
+1280,767
+1031,100
+1158,869
+48,861
+334,653
+1135,822
+1175,595
+884,885
+512,85
+484,745
+900,449
+157,852
+497,266
+946,632
+217,236
+256,661
+248,558
+47,570
+1103,766
+1215,425
+842,672
+947,362
+996,710
+1033,75
+552,812
+62,798
+862,702
+756,803
+3,466
+934,677
+1252,521
+1220,103
+570,499
+997,438
+1245,677
+30,753
+900,673
+1119,593
+716,754
+264,350
+420,484
+1144,87
+6,695
+493,504
+669,231
+1051,695
+97,522
+97,565
+954,463
+674,595
+63,292
+961,409
+348,848
+166,359
+686,767
+192,575
+848,319
+925,477
+735,182
+326,107
+470,117
+1183,620
+370,822
+349,37
+957,78
+209,781
+30,464
+62,803
+94,884
+542,36
+1307,793
+398,681
+604,450
+376,329
+175,520
+495,820
+764,504
+768,858
+241,341
+502,869
+1,726
+252,675
+157,490
+672,427
+1059,355
+1151,820
+319,168
+1016,719
+726,302
+895,371
+527,620
+1151,436
+805,647
+540,705
+1153,547
+1304,199
+817,367
+88,126
+1074,439
+1289,140
+1096,702
+1243,359
+739,401
+448,702
+858,85
+810,291
+1120,754
+1190,702
+239,523
+805,215
+920,350
+1176,211
+853,221
+985,661
+428,670
+341,438
+566,129
+333,714
+853,124
+624,767
+1240,368
+641,250
+1236,227
+1218,484
+1303,840
+587,871
+408,892
+1004,838
+109,210
+716,140
+1093,658
+773,7
+654,309
+1049,677
+674,530
+318,831
+1118,767
+997,456
+740,717
+1238,791
+848,127
+541,259
+830,8
+363,219
+584,526
+672,651
+353,816
+457,322
+112,529
+1004,56
+161,390
+900,1
+169,135
+25,862
+584,220
+872,123
+893,778
+186,672
+341,194
+303,268
+992,383
+465,368
+13,25
+1168,240
+311,516
+713,701
+646,607
+1240,526
+510,558
+723,359
+842,558
+726,880
+979,757
+1202,257
+495,773
+70,686
+753,522
+94,688
+753,428
+273,532
+197,501
+485,722
+840,848
+420,816
+186,149
+698,403
+363,676
+1262,861
+512,112
+1201,658
+129,98
+1022,309
+1263,324
+569,660
+74,675
+80,409
+177,232
+455,4
+818,527
+480,397
+186,222
+1114,581
+783,620
+1201,236
+197,893
+1118,95
+489,728
+388,140
+604,242
+1216,240
+797,754
+756,539
+797,37
+1173,872
+622,623
+489,815
+117,143
+291,184
+863,128
+730,765
+73,722
+892,7
+488,535
+813,628
+940,822
+552,318
+273,840
+1086,289
+1280,464
+822,311
+149,295
+477,697
+391,588
+1237,348
+262,483
+6,199
+584,592
+485,539
+390,126
+490,738
+1170,373
+1140,297
+934,637
+396,436
+1233,385
+733,765
+947,219
+349,485
+490,746
+643,338
+1084,511
+979,122
+408,555
+820,290
+669,25
+1253,701
+813,72
+999,378
+1176,855
+1124,745
+132,780
+706,204
+581,157
+667,556
+562,410
+808,869
+428,383
+3,101
+996,632
+261,746
+577,10
+830,886
+489,838
+344,742
+1136,845
+398,661
+398,238
+1019,787
+142,649
+584,302
+438,771
+288,302
+1161,295
+92,634
+606,145
+970,632
+1034,74
+1079,894
+142,240
+1275,710
+820,746
+1173,22
+74,577
+855,890
+689,501
+497,347
+358,688
+636,364
+567,819
+1022,302
+758,736
+1253,253
+428,501
+821,815
+887,21
+1213,490
+764,705
+60,306
+1153,255
+1056,327
+601,168
+1099,634
+880,718
+1146,604
+1213,18
+1178,780
+822,535
+1161,471
+952,127
+1201,210
+688,623
+574,221
+890,634
+170,597
+157,42
+1084,393
+310,661
+666,8
+375,548
+597,193
+390,544
+65,677
+263,180
+621,449
+1165,714
+842,745
+582,473
+997,472
+1145,815
+25,32
+820,156
+612,520
+957,302
+770,705
+113,187
+1114,313
+825,411
+698,267
+813,347
+1236,667
+723,807
+169,815
+805,194
+1280,114
+1223,815
+820,820
+790,659
+850,101
+1250,588
+955,525
+676,782
+1113,221
+224,289
+1290,649
+284,421
+574,787
+1020,632
+1026,25
+961,530
+858,267
+1237,157
+1238,439
+952,206
+996,184
+1292,364
+969,707
+546,133
+619,555
+575,182
+584,880
+979,137
+30,268
+477,214
+797,857
+1039,582
+1144,359
+211,17
+790,235
+1180,623
+915,224
+477,471
+261,665
+833,295
+830,662
+601,138
+656,361
+922,688
+1262,145
+1231,406
+858,361
+616,816
+1290,270
+764,189
+320,689
+18,530
+813,266
+363,107
+577,436
+609,439
+560,464
+229,490
+480,886
+281,333
+202,267
+1078,10
+492,527
+929,362
+373,781
+381,586
+126,150
+246,109
+169,68
+508,691
+638,243
+741,234
+1081,404
+1290,245
+1034,298
+621,841
+821,728
+23,44
+1260,674
+1044,140
+217,628
+750,688
+1140,149
+552,736
+261,453
+192,95
+452,361
+1140,597
+726,368
+798,688
+519,147
+1082,707
+1294,19
+70,357
+840,693
+691,362
+1148,77
+311,68
+654,555
+90,710
+1049,770
+1019,184
+130,271
+403,707
+67,87
+837,593
+1213,404
+1294,518
+162,186
+893,330
+698,520
+87,75
+976,451
+157,266
+758,576
+719,154
+903,493
+822,583
+594,530
+70,144
+1153,628
+463,327
+1216,884
+654,533
+902,709
+714,597
+141,485
+634,112
+723,87
+833,231
+159,325
+977,714
+206,285
+853,572
+301,414
+1004,400
+750,884
+358,127
+1046,432
+520,235
+594,812
+801,873
+1169,37
+986,353
+1006,110
+1099,260
+915,695
+1062,784
+410,143
+1300,8
+1297,259
+348,737
+175,822
+348,157
+1037,54
+1014,849
+785,673
+518,866
+716,812
+418,119
+497,72
+1093,236
+1069,553
+566,765
+703,801
+1230,409
+1029,333
+1190,227
+94,206
+641,886
+1268,161
+1181,221
+417,116
+47,324
+1124,672
+870,140
+159,121
+440,226
+169,31
+428,462
+440,858
+395,672
+348,46
+236,632
+184,848
+735,712
+470,693
+243,782
+940,869
+154,603
+935,548
+1039,841
+490,143
+149,471
+920,880
+243,112
+706,652
+817,504
+465,884
+581,844
+914,884
+711,536
+90,343
+952,530
+1290,21
+135,595
+868,749
+1238,473
+898,667
+174,397
+1078,688
+990,689
+1272,368
+438,123
+400,262
+102,812
+1184,150
+691,666
+567,371
+982,107
+537,887
+800,110
+735,180
+32,623
+242,110
+632,334
+753,789
+411,65
+1290,737
+313,438
+900,751
+333,180
+426,457
+261,677
+440,140
+714,297
+527,172
+729,546
+673,142
+457,501
+1168,688
+1124,149
+664,383
+848,799
+480,381
+159,436
+867,821
+213,243
+378,148
+947,676
+72,473
+1133,645
+1150,653
+653,840
+912,233
+769,259
+1133,871
+913,724
+22,334
+
+fold along x=655
+fold along y=447
+fold along x=327
+fold along y=223
+fold along x=163
+fold along y=111
+fold along x=81
+fold along y=55
+fold along x=40
+fold along y=27
+fold along y=13
+fold along y=6

2021/inputs/14.txt

@@ -0,0 +1,102 @@
+SHHBNFBCKNHCNOSHHVFF
+
+CK -> N
+VP -> B
+CF -> S
+FO -> V
+VC -> S
+BV -> V
+NP -> P
+SN -> C
+KN -> V
+NF -> P
+SB -> C
+PC -> B
+OB -> V
+NS -> O
+FH -> S
+NK -> S
+HO -> V
+NV -> O
+FV -> O
+FB -> S
+PS -> S
+FN -> K
+HS -> O
+CB -> K
+HV -> P
+NH -> C
+BO -> B
+FF -> N
+PO -> F
+BB -> N
+PN -> C
+BP -> C
+HN -> K
+CO -> P
+BF -> H
+BC -> S
+CV -> B
+VV -> F
+FS -> B
+BN -> P
+VK -> S
+PV -> V
+PP -> B
+PH -> N
+SS -> O
+SK -> S
+NC -> P
+ON -> F
+NB -> N
+CC -> N
+SF -> H
+PF -> H
+OV -> O
+KH -> C
+CP -> V
+PK -> O
+KC -> K
+KK -> C
+KF -> B
+HP -> C
+FK -> H
+BH -> K
+VN -> H
+OO -> S
+SC -> K
+SP -> B
+KO -> V
+KV -> F
+HK -> N
+FP -> N
+NN -> B
+VS -> O
+HC -> K
+BK -> N
+KS -> K
+VB -> O
+OH -> F
+KB -> F
+KP -> H
+HB -> N
+NO -> N
+OF -> O
+BS -> H
+VO -> H
+SH -> O
+SV -> K
+HF -> C
+CS -> F
+FC -> N
+VH -> H
+OP -> K
+OK -> H
+PB -> K
+HH -> S
+OC -> V
+VF -> B
+CH -> K
+CN -> C
+SO -> P
+OS -> O

2021/inputs/15.txt

@@ -0,0 +1,100 @@
+5698271399793414121494916897678273334792458352199237144928619653191794144917556817941885991921787155
+5661218626919981949139858312691785612259857529334128895157352159114297128511813456894839991981828919
+1829946539172173769987529428979213588624889988719998181167931129997731961946189278688942251875931179
+1999119539431115938818955166792951461581819916221516821681692884358864981966117818421936138119178448
+8248487982679211958329811353187936515794549929583184191911666793879132359192179796818752613119298188
+7391613611139499971186919159397755657961352334771192112294557688911149919935819422199281134255797767
+8124729396114568961156298172414395681961627813193215526122172712983935817479529728239799416288287177
+9649211889945273498525484578866135611815817899936588391937238711562851327977738262898917714539618992
+1141741151396594515311116985514997126571483473844951949329748922961996548324126664446185813879832188
+6514441248746823748338931782958583948711212951974131921212693782738511196996128897191782852921157717
+9391886829151987712527174199971418888695457266233516772351113144394198243117872737133772919969819519
+1198331423874598397283651925996811591794589456846981969193281925566799829729889189889897828398875973
+3993119331859999411778999198997168314599391886293921999193929916292896686191667979558511312556596894
+4885648184914319438678987185948358172121994124174189148399374584265796556987819754991475787318732495
+7161834654516953633561499967999394938799899319729924222599794975138255185728879581989683917238688499
+5984849949933778929823916964338381451782979977879923213397398539961494556984787412996655398495998949
+5715125898984926281417488864215481241818325728147899985999237792243119997919523716364219919384984139
+9859999616929285298541192766179418656994667513839176241589982149119397731438826191347741844116719249
+8175137179841286592241832831664588945248987741981849615626887738291971771877815459199919596297762924
+1195455998712612867139126669399111711242319181378472389957511612195887919281465911167399661193991259
+6683294289715197916912936717981879539595921479689377149531198421412217683129512395995551899999253636
+4384549778929184387719457231348656645896889888925317219969479184937844937194733193727596993257773958
+3276812228776279165124713927385779131439398642869891821824228691957821333121694837396724995969152871
+9919942131189697791118151719399685129324814276422561998279371918941781591744772893513849374159719689
+9381491523919433281119518148692169889399181847183427693123932741321897894329241437714386791132191185
+9491214195479284697132149999835916255594317799411165638929858419125934487114527249742829613155512959
+6311661999995998283745198816594176551398793726177951929118916489667398222393341857119652996537191216
+6982112288787347411291733589694945315895949612819676734199121729449261277878511178985354939268994351
+3674562711198699238983994755221985299338191681822892997159181992896128148896975971957144448941814152
+9899194386288999913747123919122811877922937176682999664964885597922734185747279621687621731836928862
+2116816742597199191219978826825994722615889928911124939448369538185829869273435191136937156632583851
+4349941568369745619775621261571293998779732985286699593958874613332787391776856914459351828283129499
+2139545889871837989617135399996761155985919219131927394712919919165898258917812865693299999372143937
+2797918178177159361299151932139531949921215449467992544898132943871367946184259699282519985747111894
+1486233998921528551532861544482468798798911836599829829996424887757819971589876285997126989165281171
+8861164846365591334792621191572483286587764653747651579926829499721832813168648324199795414996798928
+9291853568543999152479124588672419544474748794822216282929683566381835292497918418175413139195238875
+4459193479395871171969518189835778911861995829613879912466644113246996925946217134981986998535612761
+3917415977315473896693284392244697742378915475693115524188981984797471519797297767819983299114674163
+9479997975888641554837851979187615719199134617129683999813865847829191959434496893219481276491982115
+1192917311668797426356261998346738779982194786382977926498879633266998527258133639952619989139917922
+7719288735263969519584635229174517995733918532265569199269899656492443157891869119696416131629593639
+2184119869185523966813259979736987537578526292398798983845392291835172615194758136222947294271887893
+8729953944813191318117475998726288371635861354847924941923488971912998769489173795899411912899358291
+4865718997911481411828882919717899614955999831128828316982172988928635967691754477941769257918149225
+2993917151292413828544861759731699793999794939134673192415919816989946192187733812832551933836349353
+2392657723121896915129994993779197965282385759494924426239478311328999729999373913937519813997858629
+1231999494818876979724169419419112419866229157682954926121898668165939174414423891657921992944249919
+9918532449129634933779591992923399274618345391686218726361524731393799762548689548319471496829728796
+9998799217976696793819516835698899484118485923118178917448293998592525822132531922781281129488216397
+5192761493599676289836184964748349843714842349297638881284681117695677295987225931879393958925236789
+7268883329987412183226822596174125816931195839329615165616819294836862793251385934133841918139897811
+6965568945376938749193143429716268629281259918717113392767177211856962116259137767717711199819531318
+9946637998921258586362681893277981845668197589625911332226897948938743394789819211693113189244919914
+4871851551891469283341781775791494521158119524555886558545149797364636497391519989229278417113895118
+1345983432979827816668993821658815763434864899249549719186967999197848321762371279955891998781349927
+6314411929798522969667512333572214219998191666968187141597233789569459669912829965921239279371936316
+3992169277898367859361361786747537912321799661448888219875991399581567758199888738334192143862413181
+2222496914541859183177213262919191272991899639234997678238191986198749293843119619698119988293199525
+5915371189328353219855382685759969775542849935211982181425259529898186916649392484997392838711191117
+8169587973671717318581118999998425389847631991852491196188179989154396999942138113786691868241134889
+5344685492577218115877995132456423826951924968919925139319849473936971671795487241479296442941929811
+1251739861149952116921832956986111819961136698717996819282184146866727525158711738228839674622782386
+9847314199798528792466291586899159199338477391961835887792183113688154215493472212798899991864295742
+5257272784491799827451173416779878548132798785993631488174276918175531348892491918523719192299467898
+7992979991181179831169821468119411577879187992796818917682661441819267843277919392835983139489719471
+4128797488218887928681673379728116122642549998949328966228125433858567196198751462818891984938354911
+3475959599312382511869439189922686358873981983568449243997159614192913999914236993319949291439999198
+1517571791296243999998371134995497132685919198842128735596841665424591185199389913668775951218689423
+5654967112585715992259299352411729124559287912759919919348673481869219527276935916149899615111454338
+7959995196194629598269761799738458135587969367688876114561929169848572742199927976195348111813159694
+8341237826999851918267518141919121565937312914613679117869654472139112992413357268683764935191892197
+9191144725134452491124119549826718699739659572818352415387359897217137915122751995997915493159884984
+6114992423997191951469189895299879231999121815923893319995434539493649119619119321913937699983662725
+8691733293139727547586431961128887545859836374323612455831994799481883935133399817678718165893368111
+9561258499233959148319937411137559674714812297689646923979591185916186723579892829686891551677119835
+3817583836164917989158856146991679117129286763822991921599939389559162988815144775134949221893987156
+8869393821317962938731194192326717912615937839319191487729718951863811937788448721968368554499469998
+9779931174618997891716996479823339528914111348193299619911134519591869598192982377992849895786861628
+9228849524211171112561193761591642939783616849941114962751144449512592397581717151998199129916399569
+3681981471397593418983945941198912291467516143121382229831485899639873221948653399284748979865113829
+4511319899177843659998889999335128559884168939718989492987161554392999453863694462822117736248363914
+6889791329888928324783251893783438993799912282811711691692819391686821652429416117277191688919199791
+1813466918799319576952728154162197258151141791197279928841612511822193355919372971629299829231292443
+6929796618267421196847896679863622321769172269232621692961879886142891298588221949715178615764931656
+2181488467213697845251891984157371193949716425395214118928493219545175866269193351849171839139818194
+9145886424872389992784162159124115362691198296549871231961989118911915871253826391146992645811797217
+7261813715196955953539695411269291743513585462916998619485955985198911978299891114856577679915119891
+2395375323918811172993132575669768211797188142297317469339437887956823821249292252996118812429293966
+3493698117398613593295939911464991949189591628859269618891373198822876449981519279397383938445938961
+7188399498811299474499795927858692591488691212476189948484913298291739588851722167749543818816918814
+6639711919811875921558499577359957913939617544713997397137148176493159178897792388987517214382594658
+9868637769618335566138613187813295523435485163161618919397998236266915715199319761642818478856959385
+1181969758279137971179348866926365624188612783894276496899793241258119122436174649949517195172514793
+6282561199121299888181471164167212292274611428169718849631799674421998399218169533259817922649993996
+7892189127116936145295482897726952912496729194898291625689311833439971918991813338319988542899569332
+1984849148728139499199899219892824339819797636941197152362487518771542766624971973432971739847999929
+1389955743198821981998929159786983988371511612124611537771554447966118799114165127857297139873268292
+7114948568589988719191915583826591117862589116475856191177131841299229935172958819245872994369999426
+4275554996585879411196552781973718511282969951492149869419418957345666452981882879663949917972311592

2021/inputs/16.txt

@@ -0,0 +1 @@
+620D49005AD2245800D0C9E72BD279CAFB0016B1FA2B1802DC00D0CC611A47FCE2A4ACE1DD144BFABBFACA002FB2C6F33DFF4A0C0119B169B013005F003720004263644384800087C3B8B51C26B449130802D1A0068A5BD7D49DE793A48B5400D8293B1F95C5A3005257B880F5802A00084C788AD0440010F8490F608CACE034401AB4D0F5802726B3392EE2199628CEA007001884005C92015CC8051800130EC0468A01042803B8300D8E200788018C027890088CE0049006028012AB00342A0060801B2EBE400424933980453EFB2ABB36032274C026E4976001237D964FF736AFB56F254CB84CDF136C1007E7EB42298FE713749F973F7283005656F902A004067CD27CC1C00D9CB5FDD4D0014348010C8331C21710021304638C513006E234308B060094BEB76CE3966AA007C6588A5670DC3754395485007A718A7F149CA2DD3B6E7B777800118E7B59C0ECF5AE5D3B6CB1496BAE53B7ADD78C013C00CD2629BF5371D1D4C537EA6E3A3E95A3E180592AC7246B34032CF92804001A1CCF9BA521782ECBD69A98648BC18025800F8C9C37C827CA7BEFB31EADF0AE801BA42B87935B8EF976194EEC426AAF640168CECAF84BC004AE7D1673A6A600B4AB65802D230D35CF81B803D3775683F3A3860087802132FB32F322C92A4C402524F2DE006E8000854378F710C0010D8F30FE224AE428C015E00D40401987F06E3600021D0CE3EC228DA000574E4C3080182931E936E953B200BF656E15400D3496E4A725B92998027C00A84EEEE6B347D30BE60094E537AA73A1D600B880371AA36C3200043235C4C866C018E4963B7E7AA2B379918C639F1550086064BB148BA499EC731004E1AC966BDBC7646600C080370822AC4C1007E38C428BE0008741689D0ECC01197CF216EA16802D3748FE91B25CAF6D5F11C463004E4FD08FAF381F6004D3232CC93E7715B463F780

2021/inputs/17.txt

@@ -0,0 +1 @@
+target area: x=14..50, y=-267..-225

2021/inputs/18.txt

@@ -0,0 +1,100 @@
+[[3,[[6,3],[9,6]]],[6,[[0,9],[9,7]]]]
+[[[3,9],[[0,8],[7,6]]],[[[7,9],1],[1,3]]]
+[8,[[[9,6],[8,4]],4]]
+[5,[[1,2],[3,7]]]
+[[[[7,7],5],[[3,5],8]],4]
+[[[5,[0,7]],3],[[5,[5,3]],[1,[9,4]]]]
+[[[[3,5],[7,1]],6],[[[3,6],[5,6]],[[3,2],5]]]
+[[[[2,0],[3,0]],[5,7]],[[4,4],[[9,9],[9,3]]]]
+[[[[8,0],7],[[7,1],9]],[[3,[8,6]],8]]
+[[6,[7,5]],[[6,8],9]]
+[[[9,[1,8]],2],[[[4,0],[9,3]],1]]
+[[7,[1,[3,8]]],[[4,7],[8,1]]]
+[[[5,5],[[4,5],[2,9]]],[[[7,7],0],8]]
+[[[[4,7],3],5],[[[4,3],[3,8]],[[6,5],5]]]
+[[[[3,8],2],[1,7]],[[[3,1],4],9]]
+[[[[2,1],4],[[9,5],[1,4]]],[[3,5],[[9,1],9]]]
+[[[6,[1,8]],[0,0]],[9,[0,3]]]
+[[[[2,2],[3,3]],[[4,8],4]],[[[6,8],4],5]]
+[4,[[[7,8],[3,4]],[[3,2],9]]]
+[[[9,0],3],[[[7,1],4],7]]
+[[[1,4],8],[[7,5],[[8,0],[0,7]]]]
+[9,[[4,6],[[2,9],1]]]
+[[[[1,8],8],6],[[[2,0],6],[0,5]]]
+[[[5,5],[6,4]],[[3,8],[9,[7,6]]]]
+[[0,[8,[1,4]]],2]
+[[[[9,5],0],5],[9,[7,5]]]
+[[9,[4,8]],[[8,1],[[8,6],[7,1]]]]
+[4,[[[9,6],5],9]]
+[[[[3,7],6],0],[[7,7],[[2,7],[9,3]]]]
+[[[6,[3,7]],[[8,3],2]],[8,[6,[8,5]]]]
+[[[5,[2,7]],[[6,7],3]],[5,[[4,4],1]]]
+[[1,0],[[2,8],[[0,4],9]]]
+[[[1,4],6],[[[9,8],[1,0]],1]]
+[[3,4],[[1,[8,4]],8]]
+[[[[9,4],[0,7]],[[5,4],[8,2]]],2]
+[5,[[[8,7],[3,4]],[2,4]]]
+[[[[1,3],[8,6]],[[3,4],6]],[[8,5],[[9,3],[5,7]]]]
+[[0,[[0,9],[7,8]]],[3,9]]
+[0,[[8,[2,3]],[[3,5],[4,9]]]]
+[[[4,3],[[1,9],[1,5]]],[4,[[9,1],1]]]
+[[[[3,6],[2,5]],3],[[8,[8,0]],[[6,9],[5,8]]]]
+[7,[[3,[3,6]],[[6,9],[2,7]]]]
+[[[[8,3],[6,5]],[[3,9],2]],[6,1]]
+[[[2,0],[2,3]],8]
+[[1,[[8,7],2]],[[[9,4],8],[4,[9,0]]]]
+[[[6,7],[[5,2],3]],[[0,5],[[9,4],[2,6]]]]
+[[[9,[5,8]],[[9,3],[6,9]]],5]
+[[[5,[4,6]],[5,[3,2]]],[2,[9,[5,4]]]]
+[8,6]
+[[[4,8],[3,1]],[1,[[7,8],[7,5]]]]
+[[4,[[8,8],4]],[5,[8,[3,9]]]]
+[[[4,[9,0]],[[0,3],5]],[[5,[3,0]],[6,[2,3]]]]
+[[[4,0],8],[[[4,0],7],[[9,6],3]]]
+[[8,[[7,8],5]],[[[6,2],8],[1,[0,4]]]]
+[[1,[[3,4],[0,8]]],[[6,5],3]]
+[[5,2],[[8,6],[1,[9,7]]]]
+[5,[6,[[1,3],[1,0]]]]
+[[0,[[1,9],[5,6]]],[[[6,2],[5,1]],[[1,2],[1,0]]]]
+[[[7,1],4],[[[0,3],3],[[4,8],1]]]
+[[3,[9,[3,4]]],[1,[[0,0],[1,4]]]]
+[1,[7,[1,[3,7]]]]
+[[[0,[5,6]],[[7,4],[5,7]]],[[[6,8],[4,6]],9]]
+[[[9,8],[7,[1,3]]],3]
+[[[4,[0,3]],[[3,0],6]],[[2,[9,2]],1]]
+[[[[1,9],[3,3]],[8,1]],5]
+[[7,[5,2]],[[4,[0,1]],[3,3]]]
+[[[6,6],[0,6]],[[3,[5,9]],[[4,2],[4,3]]]]
+[[[7,[5,4]],[7,1]],9]
+[[6,[5,2]],[[7,[0,5]],4]]
+[[[8,1],[[7,6],[4,1]]],2]
+[[[[4,3],[1,4]],[9,6]],[3,[[2,5],3]]]
+[[[[9,3],[5,0]],1],[1,[[9,7],9]]]
+[[[8,5],[5,9]],[2,[4,[0,0]]]]
+[[[[7,9],2],[[8,8],[6,3]]],[7,[0,9]]]
+[[[[6,6],[0,2]],[2,[9,0]]],[[0,9],[9,9]]]
+[[[9,[1,3]],[6,5]],[[[1,1],8],[9,[7,2]]]]
+[[8,[[8,4],6]],[[4,[5,9]],0]]
+[[8,[5,[6,7]]],[[[1,9],9],[0,[0,9]]]]
+[[9,[9,[7,3]]],[4,[4,7]]]
+[[[[9,3],7],5],[[5,[8,5]],[0,[8,0]]]]
+[[[5,[9,0]],[[7,4],[5,3]]],[3,[[1,1],[1,8]]]]
+[[1,[[1,4],[5,9]]],[[[9,1],[6,5]],[9,[0,7]]]]
+[[[[9,4],9],[5,3]],[[[4,2],[2,2]],[[1,0],0]]]
+[[[6,[8,6]],9],[8,[[0,1],[9,7]]]]
+[[2,0],[5,[[8,3],4]]]
+[[[[0,2],0],8],[8,[[2,5],[8,2]]]]
+[[[[7,4],8],[9,[7,5]]],[8,[7,[5,3]]]]
+[[2,4],[3,[3,8]]]
+[[5,4],[[0,[5,8]],[4,3]]]
+[6,[[5,[4,7]],9]]
+[[[2,[6,8]],[5,5]],[[[3,0],4],[[6,6],[0,1]]]]
+[[[1,[4,2]],[[8,0],8]],[8,[[6,1],[0,0]]]]
+[[9,[2,[3,3]]],[[2,6],[[5,2],[5,8]]]]
+[[9,[4,4]],[[[8,6],1],2]]
+[2,[[[0,7],7],[[7,8],5]]]
+[[[4,0],[[1,1],[7,6]]],[[6,7],[[7,2],1]]]
+[[[[2,5],0],[[9,5],9]],[6,[7,[6,1]]]]
+[[[7,8],1],[[[6,2],0],[[9,7],[3,5]]]]
+[[[9,1],0],[3,[[6,1],[6,9]]]]
+[[[[9,0],0],[4,[7,0]]],[[6,[4,0]],[8,[4,2]]]]

2021/inputs/19.txt

@@ -0,0 +1,921 @@
+--- scanner 0 ---
+-377,550,716
+405,-463,594
+-612,-603,479
+-673,637,-463
+536,-465,715
+821,322,-697
+-676,-693,500
+643,432,654
+366,-500,-472
+708,409,-755
+469,-498,555
+738,371,759
+600,282,729
+362,-630,-324
+-446,-778,-395
+-679,-672,612
+-450,654,697
+353,-429,-389
+-661,719,-393
+118,-178,-1
+702,313,-718
+-540,-676,-341
+-716,754,-469
+-313,635,722
+-546,-749,-540
+-46,-64,45
+
+--- scanner 1 ---
+-393,569,-783
+823,673,744
+492,605,-667
+568,-702,420
+498,-690,338
+-442,536,-928
+-458,-493,-747
+-617,-342,422
+-654,709,686
+539,-496,-476
+540,570,-668
+-416,521,-829
+756,-480,-461
+-387,-515,-848
+-549,614,625
+-611,-406,507
+666,628,-671
+-592,-479,403
+632,-478,-385
+802,792,735
+860,679,648
+27,17,-91
+-624,571,775
+-535,-422,-848
+574,-745,303
+
+--- scanner 2 ---
+558,-741,-564
+646,-807,485
+464,437,812
+-898,-528,468
+616,-770,-508
+-127,-22,17
+351,393,-850
+532,-629,-522
+-680,-690,-789
+600,353,768
+-655,-827,-770
+593,-678,448
+675,-648,590
+-808,525,-539
+-765,-461,537
+335,474,-887
+-777,396,-580
+241,407,-941
+-787,793,667
+-973,848,720
+-661,-763,-685
+-789,519,-676
+449,424,815
+-815,754,730
+-42,81,-107
+-877,-464,558
+
+--- scanner 3 ---
+-436,572,-578
+746,-456,727
+-475,513,-649
+-451,-549,481
+-562,-572,-515
+774,-516,696
+-704,791,507
+768,-722,-551
+812,-661,-568
+-613,684,551
+700,767,716
+-303,592,-650
+116,21,-89
+-408,-507,547
+753,-717,750
+609,753,-601
+-62,-9,37
+553,672,-596
+836,-673,-599
+-467,-404,-483
+-660,817,634
+-609,-356,-546
+602,796,-590
+692,646,766
+-565,-477,532
+702,620,743
+
+--- scanner 4 ---
+538,-453,-833
+-126,24,29
+-352,-473,-587
+-444,-449,-740
+691,-464,520
+626,828,344
+-565,-317,406
+775,942,-788
+-369,-409,417
+-708,823,-645
+727,935,-697
+-746,539,507
+-806,434,481
+-789,742,-763
+-556,-362,404
+-690,470,523
+593,877,489
+405,-436,-796
+317,-447,-785
+-404,-427,-788
+-13,189,-5
+-698,727,-823
+600,898,-737
+561,-551,518
+641,854,443
+733,-626,469
+
+--- scanner 5 ---
+46,10,147
+758,-651,532
+-527,-618,452
+-823,464,-569
+690,764,759
+-564,-447,-551
+764,-302,-267
+684,881,802
+456,449,-735
+435,440,-616
+107,94,-30
+760,846,747
+-677,-709,468
+-647,455,-499
+-408,-549,-539
+398,536,-622
+-293,614,774
+829,-503,-276
+-385,-416,-489
+-272,801,808
+-563,-622,372
+-612,469,-575
+613,-622,632
+-278,753,780
+681,-373,-280
+812,-549,626
+
+--- scanner 6 ---
+579,574,-541
+-505,493,-632
+618,658,359
+-341,743,774
+-322,-636,574
+716,580,-522
+366,-369,516
+-654,544,-722
+401,-424,440
+-413,-618,481
+-785,-692,-593
+-785,-599,-445
+466,-635,-650
+675,451,-553
+89,132,-70
+-427,825,855
+-398,-634,698
+570,-708,-669
+-60,27,13
+522,657,457
+-376,606,841
+-684,-621,-516
+485,-772,-675
+475,716,376
+-647,496,-573
+483,-412,510
+
+--- scanner 7 ---
+512,585,-747
+807,772,880
+733,795,840
+-767,-876,-603
+-719,662,750
+-612,458,-552
+570,-882,858
+-589,-932,-661
+623,-601,-378
+-343,-464,739
+-589,632,-556
+746,-608,-532
+494,492,-838
+-652,610,660
+-554,584,-555
+111,-115,-49
+589,-757,885
+-618,631,899
+496,368,-762
+618,-644,-539
+696,-814,921
+-640,-913,-544
+737,746,813
+-310,-533,587
+-23,-193,76
+-85,0,-51
+-447,-527,622
+
+--- scanner 8 ---
+-419,640,-664
+-722,-533,531
+705,861,595
+577,-689,716
+-842,-385,512
+632,-792,-344
+815,768,660
+490,-691,586
+-502,623,-798
+-554,-811,-585
+676,809,607
+560,496,-785
+-943,400,567
+415,-740,758
+679,-805,-531
+732,438,-813
+-792,347,621
+724,-803,-540
+-489,-738,-726
+-746,-370,499
+-2,59,-33
+558,494,-753
+-515,574,-768
+-486,-634,-564
+-122,-93,-71
+-872,325,554
+
+--- scanner 9 ---
+506,-688,-561
+571,721,622
+503,-562,-503
+-709,-714,-463
+-835,437,457
+-948,-735,-497
+314,-589,962
+495,809,-475
+-788,360,-772
+-612,-499,488
+291,-602,907
+-580,-584,424
+-119,8,40
+-636,429,-805
+408,627,663
+555,634,776
+301,-483,836
+-799,-766,-396
+-671,423,-668
+-725,535,411
+10,-85,163
+554,772,-348
+-726,558,457
+507,-736,-526
+612,828,-526
+-444,-607,500
+
+--- scanner 10 ---
+-643,-839,-726
+-663,-800,-791
+-17,49,1
+-428,-762,319
+-452,-869,434
+806,-584,-592
+-468,406,-817
+118,-97,56
+530,403,850
+-433,399,-634
+521,-484,654
+881,-476,-533
+954,-520,-545
+781,439,-557
+609,-463,682
+-327,671,688
+-542,-771,-726
+-328,557,674
+661,-458,693
+510,298,863
+-240,536,611
+785,322,-393
+-432,416,-779
+-475,-744,471
+518,305,832
+823,411,-365
+
+--- scanner 11 ---
+-559,-302,-674
+-766,553,760
+-687,-322,850
+-800,-238,758
+370,-773,-566
+-851,883,-504
+-804,954,-655
+-716,-388,-711
+17,134,92
+884,-743,798
+905,900,-296
+-681,-359,-759
+-84,7,-30
+851,833,-390
+-756,459,918
+479,-816,-448
+-848,870,-519
+707,-731,809
+814,914,-406
+503,782,753
+544,911,722
+767,-719,748
+640,788,734
+572,-776,-603
+-781,-228,812
+-703,514,732
+
+--- scanner 12 ---
+-593,845,571
+-95,162,7
+-509,-378,-516
+504,-445,343
+-400,708,-674
+-554,-465,-583
+431,-519,471
+-473,-359,-516
+-592,828,716
+-931,-358,491
+-906,-487,413
+-628,838,754
+-487,573,-751
+370,841,-913
+625,922,330
+663,833,302
+429,-748,-651
+358,939,-895
+244,-687,-680
+-794,-417,415
+621,805,494
+350,946,-926
+351,-656,-694
+-488,687,-737
+575,-504,385
+
+--- scanner 13 ---
+-540,634,673
+764,-806,-384
+489,306,-588
+141,-5,-53
+577,221,-522
+-383,-685,663
+-575,616,539
+-558,-546,-541
+-444,-533,-673
+-356,-714,588
+-603,633,440
+791,-862,408
+763,728,555
+610,-722,-434
+758,-918,432
+693,-743,468
+-611,661,-390
+607,-706,-368
+-1,-144,-29
+-280,-701,796
+-706,583,-501
+-709,727,-493
+764,719,476
+763,692,397
+643,299,-606
+-566,-523,-601
+
+--- scanner 14 ---
+-636,680,-483
+718,525,642
+822,571,-429
+534,-636,-655
+-464,-684,-415
+34,31,141
+-600,748,862
+-629,673,889
+719,758,705
+-438,-516,679
+-448,-588,801
+780,425,-363
+-616,881,965
+467,-723,-700
+-462,-614,-303
+806,549,-467
+668,-416,539
+746,-305,634
+-461,-456,687
+701,624,670
+-795,747,-546
+-726,811,-463
+-540,-743,-278
+-82,-24,3
+812,-408,536
+467,-742,-736
+
+--- scanner 15 ---
+570,716,-401
+813,-522,-700
+-565,-663,616
+577,-384,448
+71,-43,-130
+-641,-610,619
+-731,-539,-421
+-448,392,521
+563,363,512
+-486,-548,601
+792,-612,-764
+638,513,555
+-760,-644,-580
+680,-591,-767
+533,452,650
+-701,454,-458
+698,-382,317
+-309,433,468
+576,631,-465
+-18,83,4
+-617,468,-599
+737,-417,381
+-678,-502,-550
+-643,510,-487
+595,735,-538
+-419,340,533
+
+--- scanner 16 ---
+-99,-26,105
+-171,-173,17
+-808,-569,-752
+-430,-810,823
+276,298,847
+-545,545,909
+406,-582,-466
+797,-624,681
+-592,481,-545
+-566,579,670
+483,-511,-365
+283,346,756
+390,447,-285
+766,-707,633
+341,480,-430
+-591,-585,-737
+814,-646,819
+-404,-880,890
+-381,-806,850
+-544,516,-546
+-514,646,760
+320,473,796
+-718,539,-542
+364,432,-384
+-684,-567,-828
+335,-604,-365
+
+--- scanner 17 ---
+-814,515,-501
+351,736,-672
+-840,-376,629
+-809,-483,615
+420,355,558
+452,-906,-323
+-512,341,793
+461,-873,-478
+534,356,572
+-618,422,726
+-901,-561,658
+-866,536,-417
+346,616,-702
+-798,-485,-246
+-31,-18,-10
+-785,-377,-340
+786,-490,414
+-885,-489,-394
+278,697,-583
+-163,40,154
+-828,605,-546
+-531,377,793
+555,268,635
+793,-482,383
+688,-502,396
+346,-856,-366
+
+--- scanner 18 ---
+-599,-418,-687
+485,631,359
+-642,-843,277
+894,-574,-927
+137,-133,-101
+-513,528,790
+-703,425,-406
+623,-464,487
+843,-793,-941
+616,-512,636
+-661,-584,-635
+857,650,-567
+765,-461,546
+-612,-497,-702
+-561,611,821
+-770,355,-380
+485,724,507
+929,-711,-860
+-699,589,838
+948,668,-660
+-730,429,-357
+-605,-829,293
+-24,-73,10
+586,653,430
+-757,-881,273
+872,666,-784
+
+--- scanner 19 ---
+805,-688,638
+106,-100,35
+673,664,467
+-736,-787,-834
+-702,-600,-813
+641,-450,-283
+561,430,-721
+-708,-739,-828
+571,-441,-459
+-562,-605,531
+-610,479,771
+590,617,600
+-611,307,692
+623,461,-542
+-300,636,-543
+755,-696,517
+-551,-598,488
+-557,-549,612
+-380,632,-579
+-77,14,78
+611,563,-698
+782,-698,664
+-396,723,-429
+546,708,493
+-539,440,712
+647,-455,-494
+
+--- scanner 20 ---
+-73,-55,-94
+679,574,-740
+412,-822,-515
+-380,370,-593
+587,593,879
+-693,453,644
+-818,416,667
+722,670,792
+450,-652,686
+608,656,791
+-288,297,-533
+457,-835,651
+-749,-809,456
+691,374,-778
+-793,-809,-818
+421,-914,-678
+113,-67,36
+-695,-740,-793
+467,-797,687
+-788,-744,476
+538,-900,-564
+-579,-816,-811
+662,430,-653
+-720,-744,577
+-333,306,-554
+-711,301,691
+
+--- scanner 21 ---
+-720,-494,-326
+-779,-506,-326
+725,743,-671
+643,-838,-672
+735,624,-742
+780,-444,760
+635,-395,727
+-773,-551,682
+523,664,668
+712,637,-797
+4,104,146
+-655,857,-500
+-883,800,504
+-152,-49,102
+-923,-626,725
+681,-418,775
+-827,-424,-336
+601,-802,-556
+520,538,726
+617,-733,-612
+-698,874,-492
+-834,-656,587
+-892,821,623
+519,490,691
+-920,866,-491
+-796,858,617
+
+--- scanner 22 ---
+80,-91,68
+564,449,615
+694,505,-425
+820,-741,761
+697,526,-537
+-542,-761,600
+-615,-889,674
+630,595,-404
+558,522,416
+-23,-171,-90
+635,-555,-793
+552,-486,-729
+-335,769,464
+464,420,470
+683,-817,702
+-344,568,399
+-75,6,7
+-833,-862,-867
+-686,-847,615
+-836,-696,-870
+615,-645,-662
+-348,698,547
+-518,733,-640
+795,-819,632
+-874,-749,-817
+-387,735,-519
+-451,700,-480
+
+--- scanner 23 ---
+-521,536,-591
+405,-522,-611
+598,-743,933
+739,728,856
+-767,828,470
+553,913,-698
+-311,-634,587
+808,645,792
+-303,-497,588
+-36,32,-25
+475,888,-569
+447,-593,-552
+-793,724,594
+533,-449,-537
+-589,-447,-308
+-454,455,-697
+649,708,725
+477,776,-639
+-632,-369,-400
+-809,762,616
+545,-781,880
+105,114,172
+-310,-582,457
+432,-740,930
+-618,-262,-369
+-454,491,-678
+
+--- scanner 24 ---
+-574,-700,-914
+645,309,-801
+511,564,648
+-735,664,363
+464,628,796
+703,-469,305
+691,-453,440
+-552,404,-633
+710,348,-821
+-763,685,451
+496,-926,-724
+702,-429,236
+-885,-631,405
+1,-36,-128
+452,672,723
+-672,-700,-757
+-928,-818,431
+-916,-845,434
+-515,279,-610
+515,-953,-752
+645,377,-700
+421,-973,-621
+-625,-803,-884
+-774,690,503
+-400,386,-586
+
+--- scanner 25 ---
+-660,-612,759
+44,-15,-25
+-564,539,589
+-501,550,610
+817,513,-563
+412,-387,533
+-535,416,-425
+-819,-717,730
+743,582,558
+666,604,559
+-690,-754,677
+790,542,-488
+836,-482,-889
+781,-535,-703
+-473,-665,-681
+-540,-734,-814
+-665,512,540
+-618,347,-489
+742,-472,-731
+341,-434,684
+425,-390,548
+593,616,664
+-555,506,-556
+-476,-644,-793
+893,526,-355
+
+--- scanner 26 ---
+283,522,745
+-873,247,471
+628,-379,499
+336,469,783
+-605,567,-596
+-904,279,268
+-675,529,-760
+-944,-764,-808
+-898,-880,692
+286,356,742
+-18,5,-170
+-93,-106,-29
+360,663,-726
+622,-869,-722
+-946,250,385
+759,-386,584
+-742,-793,-828
+629,-387,636
+-776,-774,753
+-830,-795,-768
+746,-843,-826
+600,-885,-760
+-654,540,-697
+424,732,-643
+491,573,-706
+-885,-685,732
+
+--- scanner 27 ---
+706,-520,-692
+-101,126,35
+771,564,-698
+-480,528,-493
+442,456,859
+559,502,806
+752,-472,-669
+514,541,941
+-584,455,-474
+-875,-543,521
+-499,391,-468
+-747,589,719
+771,471,-550
+-763,-660,-431
+726,-380,811
+-823,-531,550
+670,542,-627
+-782,-478,411
+677,-552,736
+675,-422,649
+851,-487,-643
+-702,-565,-536
+-852,-522,-461
+-43,-34,179
+-761,448,803
+-705,477,745
+
+--- scanner 28 ---
+573,505,-684
+8,-24,126
+428,-551,785
+857,610,665
+-56,144,29
+-507,671,603
+-723,-628,-438
+-717,-596,681
+850,592,511
+495,394,-589
+464,-393,785
+-586,488,-809
+-697,-643,701
+-698,573,-725
+429,497,-687
+523,-436,-581
+-702,-787,657
+-789,-593,-508
+-533,539,692
+935,526,599
+540,-535,-553
+-778,-650,-426
+-354,610,678
+116,29,-19
+522,-669,-518
+-553,559,-659
+437,-472,786
+
+--- scanner 29 ---
+683,-540,-630
+402,-538,-643
+-329,-493,653
+840,566,429
+722,647,510
+664,-649,866
+28,-140,-104
+878,620,-837
+-765,-884,-623
+732,696,-778
+-28,13,9
+-454,309,-532
+-327,-538,662
+948,661,-747
+-340,-585,849
+817,-625,774
+434,-525,-638
+865,-603,814
+-430,363,472
+900,551,520
+-446,294,528
+-808,-917,-481
+-563,315,-597
+-510,267,-682
+-758,-915,-590
+-404,258,412
+
+--- scanner 30 ---
+-299,482,-468
+753,540,-526
+737,658,-630
+835,-810,469
+-294,373,-321
+-718,-593,401
+-757,-504,474
+-637,-474,469
+-294,618,-363
+356,-836,-662
+-536,-675,-691
+680,719,-521
+505,718,872
+-589,832,666
+885,-853,575
+-532,795,629
+-626,-630,-705
+-56,-7,92
+385,591,857
+-380,769,678
+468,-782,-762
+517,481,906
+464,-930,-675
+-557,-759,-743
+852,-698,584
+
+--- scanner 31 ---
+-504,-722,764
+-471,-655,604
+620,778,-539
+-579,438,-698
+-750,-487,-538
+-649,474,-531
+-41,117,16
+305,-582,-421
+-635,-502,-459
+-524,762,878
+-469,-786,725
+276,-591,590
+365,-453,560
+420,460,710
+-635,417,-543
+372,470,792
+-182,-19,99
+253,-570,-392
+426,-548,665
+618,810,-537
+-697,-484,-614
+346,-635,-282
+479,460,722
+-606,786,771
+-653,734,906
+676,838,-365
+
+--- scanner 32 ---
+-839,-599,715
+351,-528,-912
+377,598,754
+-751,502,-745
+498,820,-545
+-631,-549,-889
+566,-519,640
+-706,-506,-739
+-862,-551,669
+-524,788,651
+332,607,752
+-149,64,-129
+-455,732,635
+-833,512,-793
+496,852,-547
+324,880,-489
+-419,848,677
+6,95,-6
+-763,502,-686
+479,-649,638
+380,-540,-860
+641,-691,689
+424,411,741
+241,-593,-819
+-601,-411,-800
+-813,-584,814

2021/inputs/20.txt

@@ -0,0 +1,102 @@
+#####..#.#######.##.#.#.#.#####..######...#.##.###...#.##..#####..###.#.####..#.##.#....#...##.###..#.#......####.#...#.####.#..#.###.#.#.#.###.###..########.##.#.#....#.#####.......###.#..#.#.###.###.###.#.......#.#....#.##.###.....##...#.#.#..#.#....##..#####...##...#.##..##.##.#...###...#.##...#...#.####.###...........#...#..##...##.###.##.###.....#.##...###.....#.#.###..##..#..##..#.....##..##....#....####...#.###.#######.#.##.####.....####.#.#.##.#####...#.##.##.#.##..####.#.#.######.#..###..#.##.##...
+
+##.##....#..#....#.....#..##.#...######.##.##..#..##.###.##..##.#..#..####..##..#.#..###..##...##.##
+..##.###.##..##.###..#.###....##.#.#...##.#.#..####.#..#..##...##......###...###.#..##...##.##.##..#
+.#..####..##..###..#.....#....##....###..####.##.##.#.#.##..######..#####.#...##.#..##..##..##...##.
+..###.......##.#..#.##.##.#..#######..##.......###.###.###.#..###...#.#####..###....###.##..###..##.
+.#..####..###.#.#..#.#..##...#...#.##...##..##..##.#######.....#.#..#.#.#.#.#.#..#.##......####..##.
+##..#...###.##....####.###.###.#.#.#........##...#.#....#######.######...##.###...##.###.##.######..
+##..##...#....#....#####.#.....#....#.#..#.#.##...##.##...#.####...#####.#.#.##...#..##.##.##.##..##
+..#..##..#..#...####....#.....###....##.#..#...#..#.##.#....#.#.#...##.#..#..#..##....#.##..#..##.##
+..##....######.###.#.....##.##....###...#..#.....#...###.###....#...#.##.####..##.###....#####...##.
+.#..##.###.#......#.#####.####..####......###.....####..####..####..#.######.####..##.#...#.##.####.
+####..##.##.##..#.#...##.####..####.#...#.#.##..#.###.#.....#....###.####.###..#.#..#.#...#.#.##..##
+.##..#....###..#####.##.....###.##.###.######.#.###.#.##.#.#######....##..#.#.##..#.##...#######..##
+###.......###.....#.#.##....##..#.##...#....####.##.###.....#.####..#........#...####.##.#.##...##.#
+##.##....##..#####.#...####.....##..#..#...##.#...##.#..#..########...###.##...#.##...##.#..##.##...
+.#.###...#.###..##...####..#.###.##.#.#...#..###.#.####..#..##.##.####.###...##.##.###..#.#.####.##.
+#..#.#.#.#.#.#.#..#####.#....####.#.......#..#####..##..#..###....#...#..###.#..###.##..#.###.##.###
+....##..##.###..####.#.###.##.....#...#...##.##.#.###..##.#.#..#....#.####.##...#.#...#.#...###...#.
+##...#....##.#....###....#..##.##.####.#.#.##..##.####...#.#....####..#.##.....#....#...#..##...#...
+#.##...#.##..#.##.###..##...##.#.#..##..#.....###.#.####....#######.#.#.#####.#....##.#.....####....
+.....#####..###...#.#.#.#...#.#..#.###..##.##....##.###..###..###.#.#...#.#.##.###...#...##.#..#.##.
+...###.###.###.#..#.#.####.##...##.##..#####.......#.##.....#####..#.#######...#..#.###......#######
+#..##.....###..#.###..#..###.#.##...#...#......#.###..#...###...#..##......#.....##.####..##...#...#
+.....##..#.#.#..#.#.#.#####...#..#.......#..#..#....#..##..##.#.#..#.####..#...#..##...##...#..#####
+...##..#.#...#...#.####..#.##.###..##..###.......#..######.#.###.#..#.##.###.....########..#..#...#.
+#.#...##...#.##.##.#..#..#.#....##.#.#...#.#..####.#...#.#..######.#.##....#.#...##....#..#.#.##.###
+...#####.##.####.##...#..##.#..##...#..##..#.##...##..#.#.###......#.###.#.#..###...##..##.##..###..
+.##...###..#....#.#.....#..#.##..###.#..###..###.#..#.#.###..#...#..####..#.###.##.##.#.#.#..#..#..#
+.#..#.#.#..#####.##...#.#...###.####.##..###....######.##..##.#...#.###..###.###....##.#......#.##.#
+#..####.######....###..####.##.##.....#.##.####.##..##.#..##.#.#.#.##.##..#.###.##..####.##.#.##..##
+....#.#..........#.##....#.#..#.###.##.####.#.#..##.#..##.#..#.....###.#..###.######..##.#......####
+...#..#.##.###########...###.###..##......#..###.#.#...##.##...####.##..#.........##...##.###.###.#.
+.##.#####.#...#.###.#..#..#.#..#.##...#.#..##.#.####.##..######....##.####...#..###.####.#...##.#...
+...#.##..#..#.#..##..#.#..##.....#.##.#....#..#..#.#......##.####...####...##......##..##....####.#.
+####.##.#...#....#.#.#..###.##.###..#.###.#.#..#.##.##..##.##.#.#..#.####...###.####.##.....#.#...##
+#........#.###..#.#.#####...#.##.#.###...#..#...##.##..#.###....#.###..#.#.#.###.#.##.#....#......##
+...#.##..##.#..........#..#....###.#..#..#.#...###.##..#.#...###.####...####..#.####.######.#....#..
+##.#.####.##.#.##..#..##...###...###.##..##.#####..###..#..#.#..#.##...#.####...##.##..#.#.#..###...
+#.####..##..#.#..##..##.#..#..#...#.###.#.##.####.###.###...##.#####..##..####...##.##########.#.###
+####.##..###.####.#.######...#..#.##.#.....##.#....#...#.############..#.#.###.####.#.#..#.###....#.
+..###..#...##.#.##.##..######.###.###..#..#####....#.#....####.#..#.......##..#####.#...#.#.##....#.
+.#.##...#..#.##.####......#.#......######.#.#.##.#..##..#....##..##....#.##.###..#.##..#.#.....##...
+###..###.########..####.###.#...###.........##....##.##..#...#.##..##..#.#.####....######..#..#...##
+##.#..###..#.#..#...##.####.#..##..##...###.##.#......#........###...#.###..####..####..#####..###..
+#.##...##..##..#.#.###..###...###.....#.#.######.....##.....#.##..##.#...###.###.#.#..#.##.##.##.#..
+#..#.#####..#..#...#.#...#..##.#..#.###...#..###.###.#.#...#.###..#.###..#..##.##......##...#...###.
+#....#.##.....#.#...###....#..#.#.#..##.##..###.###..#..#.#..##.....###.#.#.#...#.##.#..##....####..
+#..#####...#...#####.###.#..#..#...####.##.#.#..#...#.####...##.##.....#.#.##.##.##.#....#.######..#
+###...##..##.##.##.#..##.##.#.##.##.#..#.#####..#.#..#.#..####....#.###..###...####.#....#...#.###.#
+##...####...##.######...#...#..##..###..###..#.##.#.#.#...##.#.###...#...########..#.#######...###..
+.###...#.#.####.#.#...##.#.###.#.###.#####.###..##.#..###..#.#...##...#####..##....#..#..##.#.#....#
+...#..#....#..#....#.#.##..#..#####....#..#.#..####..####.####.###......###..#..#..###.##.###...###.
+#.#...#.###.###....#..###..###...#..#####..#.##........###....###.###.##.###.#..##..#.....#.#.####.#
+#...#.#...#.#..#..#.##.##.#......#.#.#..###....#.#.#.#..#.#.###..#..#..##.#.#.#.##...#..###.####..#.
+#.#.##.####........#.##..#.#.#...##..#.#####.#..#.#..#.##.#..####.###.#####.#.##.#....##..#####.####
+#######.##..#.#..#...#..#..#.######..##.#.###.#...#..####..##.#.##.###.#.##.#.##..#...#.#..#.#.####.
+.##..#####.##.####.##.#....##.....###.......#.####.###....#...#.#####.###.#..#...##.#..##.#....###.#
+..####.#.#.....#...###.#...#.#...#.####..##..#..######......#...#.##.####..#.......#.##.......#.###.
+.##..#.#####..##..##.#..####.##.##.#.###.#.#.....#.....#.#...####....##.##...####......##.##.#######
+#.#.#..###..###..##.#..##...###..###..#..#.###.#..##.##...##..#..####....####.##.#.###...#..##.#.##.
+##.##.....######.#..##.#.#.###.##.###.##....######.##.#.##..#..##...#...#..#.#.#.######..#.###.##..#
+#..#.#.###.#.#.#.....###.######..##.##.#.#...#####.#...##.##.##.##....##....#..#.##.#.##..##...#...#
+..#.....#....#...#######..#.#.#.#.###.##.#.##.###..#..##..###..#.#####..###.......####.#..####..#...
+#..#.#...##.##..#.#.....###.##.#.#....###....#.##..#....#####.##.#####..###...####.#.#.#.###.#....##
+#....##..#..##..#.####..##.##....####..##..#..####.######.##..#.###.#.##....###.#....##....##.#.##.#
+.#.#.#.##.##...###.#.#...#...#..######.##.#.#.##.####.....#.#..#.######.......##.#####..#....#####.#
+.###.#.##...###.....##..#.#..##....#.###..##.##..####..##.#.###..##.#.#...##.#####.#.....#..#..#####
+#.#.###..#....####....#...#.###.#..#...###..###......##..##.#.#..#....#......###...##..#.##.##...#.#
+###.####.##.#.##.......##.....#.#.###......##..#.#....###..#.#.##.###.##.##.##.#..#.####.#......###.
+####...#...##...#.#.#..######.#####..##...#.##.##.####.##.#.##..#..#.#.##.#...#......#.##.#######...
+.##...#....#.##.#...#..#..#.####..#.#..........#.#.##......#.##.######.###.#####.#.#####.###.####...
+.##.##.##.###..###..##.#..#.###..#####.#..##.##.#.####....###.#..###...##..##..#.##..#...#..###.##.#
+#.....##..#...##.#...#.###.##..#.....##..#.##...#.##...#.#.##.#...#.#..###...#...#######...#.#.....#
+.######..#.####.#.##.##.#.#.#.#.###.#######...#..####.#.#..#####..#.....###.##...#.###.####.#.#.....
+#.####..##...####.##.#.##...####..##.#.#..####.##.#.###.##..##.##..###.##...##........###..#.#.##...
+#...#.##.....###.##.....####.####.##.##.##....##.#.#.#.##...#.#.##..#..##.....##.#...##..##...##..##
+#..#.###.#....#.##...##...#.#......##.###...#......##..#..##...##.#..###.#..#.#.#.##.........##.#.##
+.#.#..#..#.#..##...#.#...#..###.#...#.#.##.##....#.##.#...#.##.#..#.#..##..#.##...#.#.#..###.#.###..
+###...#.#..##.###...#..##.#..##.#.######..####..#.#.....##....##.####.###...#.#...#.#..#..#.###....#
+.####.###..##.##...#.....##.###.#..##..####.....#....##.....#....##..##...##....#..#..###.#...###.##
+..###..###.#.#....#.##........#...####...####...#.####.##.###.##...#.####.#.###..###.##...##...#.#.#
+###.#..#.#...#.#.#.....##.###...#..###.#....#.##.##.###..#######.###.#...###.####...#.#.###.#...####
+#.#....####..#.#.###..###.###.#.#.##...###.#..###.#.#.#...###..#...##...#..#..###..##.#..#.##...###.
+.###..##.#..#.#.#####.#..#.........##..##...#...#.#...##..#.##...###..#.#.#..####....#.####.##.#....
+##.....#######....#.###.##...##.##.#####.#....#########.##....##.###...#.###..##.###.#..##..#....#.#
+...#.##.#.......#.#....#..##..#..##...#.#.####...###.##..##...##.#.##.#.###.###.###..####..#######.#
+.#.###...##.##.#.......#.#...#..#####...##...#...#.#####.##.#......#.##...#.###.#.#..#.#..##..##.#.#
+...##...##.#.#...#...#.###..###....#.##...##.....#...##..##....#..##..#.#..#.#.#.........##.#####..#
+........#...#.......#.#..#..#......##..##...##......#.....#.#.......#.#####.#.#.#..#...#####.#..####
+#.#.###...###....#...######...#.#.#####.##..#..##.##..#..#..#..##...###..#.#.#..##...#.#.#.#.####..#
+.#..#...##...#....#.#.##.#.#....##.#....#...#.#.##.....#########.#....#.##..#..#.#.##..#.#..###....#
+##..#.#.#..###.....###.#..#.##..##....###.#..####.#.#.#..######..###..#.#.#...#...#...#.#..#.#..###.
+.#.##.#.####....#..#.#...#.##......#..#.....#...#....#.##########..#...#.#.###...####..###......##.#
+###...#....###.#.#..#...#..####.#...#.##..#.##.#...###.#.#..#.###.###...#......#..#.##.#..#####...##
+.###.##.#..###...#..####.###...#.##..##....######.#..##...#...#.##.....#.####.########.##....#.##.##
+.......######.#...#...#.###....##..#.###.#...##.##..###.#..##...#..########.#.#.#...#..#..##.##..#.#
+..###.##..#..#####.#.##.#..#...##..#.#..###.###....###...#..##......###..#....#.#.....#...#..##.#..#
+###..##..#.#....#####.#######..#..##...#..#...#.#........#...###.#.###..##.####..#.####.#..#..#...#.
+...#..###.#.#.#.###...#.......####..###.#.##.####.#..#.#..#########.#.....#...##..#.#.#..#.#.#.#...#
+####.#..##.##..#..###.######.#.#.###...#####.#.###.#####.#.#.#.#...#.#.#...#.#########.#..###.##.###
+.##...#.#.###....##..##..#.#.#.#.#..#..##.###...####..#..#.#.#.#####..##.#.#.##.##...#.....#...###.#

2021/inputs/21.txt

@@ -0,0 +1,2 @@
+Player 1 starting position: 9
+Player 2 starting position: 4

2021/inputs/22.txt

@@ -0,0 +1,420 @@
+on x=-33..18,y=-35..11,z=-49..2
+on x=-14..32,y=5..49,z=-42..5
+on x=-28..18,y=-38..10,z=-14..33
+on x=-40..6,y=-22..32,z=-32..13
+on x=-14..37,y=-37..12,z=-31..19
+on x=-24..30,y=-40..6,z=-19..27
+on x=-29..15,y=-44..7,z=-22..22
+on x=-49..2,y=-29..15,z=-1..48
+on x=-1..45,y=-6..39,z=-16..37
+on x=-15..30,y=-35..14,z=4..49
+off x=20..39,y=29..46,z=-30..-15
+on x=-36..9,y=-8..38,z=-38..10
+off x=-22..-4,y=10..19,z=-4..10
+on x=-43..9,y=-37..16,z=-24..23
+off x=10..29,y=1..10,z=-2..16
+on x=-18..34,y=-39..8,z=-31..23
+off x=-2..7,y=-41..-23,z=4..23
+on x=-18..31,y=-27..27,z=-23..25
+off x=17..33,y=5..14,z=-26..-7
+on x=-29..25,y=-1..44,z=-5..44
+on x=-2089..22263,y=63383..83317,z=1521..34560
+on x=16324..26707,y=-76181..-51644,z=27623..60727
+on x=-95252..-74929,y=-36262..-8635,z=-14014..-4726
+on x=26087..56689,y=13866..33100,z=-77678..-54222
+on x=-58261..-34558,y=-52429..-39076,z=-46433..-17880
+on x=38567..59604,y=66243..73633,z=-4724..7559
+on x=-76223..-52004,y=-4022..17420,z=-56813..-31010
+on x=-28531..-6777,y=52497..78911,z=39320..53754
+on x=-1705..20943,y=71494..92397,z=2586..17205
+on x=43970..50168,y=-44993..-18711,z=-68417..-46597
+on x=-2878..23564,y=41697..70518,z=42674..68678
+on x=22987..51001,y=-74194..-62557,z=-40942..-24407
+on x=10735..33969,y=26636..35170,z=62555..84961
+on x=-87260..-58460,y=-25011..9170,z=-40488..-16433
+on x=-41317..-19098,y=55028..74495,z=9284..32979
+on x=57730..86394,y=-5618..4073,z=8825..29287
+on x=70498..95095,y=-26060..-15204,z=-11673..3577
+on x=-12181..6283,y=-76734..-56136,z=-41358..-26351
+on x=55479..68566,y=-65998..-51191,z=-388..13824
+on x=-7142..9719,y=17804..41523,z=-73454..-51015
+on x=-6780..13903,y=64955..76512,z=-35477..-12220
+on x=8140..17232,y=-84619..-62523,z=-28417..-860
+on x=-59883..-49433,y=-65970..-42610,z=8348..17483
+on x=-46361..-34652,y=-77141..-58593,z=-32375..2092
+on x=18682..23347,y=-70715..-62353,z=15488..48836
+on x=13625..33572,y=-53090..-39232,z=38313..62732
+on x=-7845..8128,y=72275..83684,z=9204..44598
+on x=30099..52396,y=-37319..-13384,z=-65551..-51334
+on x=66812..86665,y=-12147..-8315,z=-14456..18299
+on x=-80768..-62714,y=12166..32801,z=9298..28465
+on x=32917..51529,y=-39942..-11579,z=-77830..-58654
+on x=6795..30180,y=-52748..-23421,z=-79235..-66193
+on x=41104..59365,y=-65904..-44389,z=-58998..-32127
+on x=46835..68448,y=-13278..-4034,z=47409..74764
+on x=61812..89996,y=-11979..17125,z=-42861..-30521
+on x=36211..58568,y=65204..73638,z=-2374..22331
+on x=24752..29245,y=68946..77065,z=21993..33524
+on x=64234..90251,y=15294..35642,z=26838..33725
+on x=-19948..6112,y=-38109..-27877,z=62697..87704
+on x=-45769..-27330,y=-76264..-42424,z=34120..46556
+on x=-64655..-37560,y=32027..51779,z=36246..55408
+on x=46729..77810,y=30499..52592,z=22011..48493
+on x=-59194..-47087,y=61036..63539,z=-9127..12439
+on x=31894..45260,y=56306..80190,z=-39056..-4346
+on x=-28505..-11114,y=76279..91855,z=-17517..2342
+on x=-29827..357,y=-55982..-33070,z=53295..78681
+on x=61904..90365,y=-45148..-26196,z=-31689..-11315
+on x=-63745..-30029,y=-60515..-23200,z=-53318..-41274
+on x=35857..48971,y=-18159..16867,z=-83848..-48218
+on x=-58426..-37407,y=47038..72640,z=2498..22588
+on x=40878..41799,y=-86884..-48581,z=2168..20716
+on x=-26137..-535,y=60867..81985,z=-60883..-30553
+on x=-49390..-18873,y=19679..41934,z=64209..74274
+on x=-13205..4850,y=-54788..-33129,z=-74136..-52452
+on x=34452..69258,y=-18117..-14331,z=53496..73956
+on x=-26084..-6353,y=-28975..-2494,z=57753..84222
+on x=-55087..-32324,y=-62117..-47889,z=-36986..-26405
+on x=-49256..-42251,y=-58341..-32455,z=35370..57488
+on x=-29709..1208,y=44395..60836,z=44943..75568
+on x=9674..39186,y=-85531..-68265,z=11474..22020
+on x=-54733..-30617,y=-57541..-41688,z=44653..71542
+on x=58013..78420,y=-31202..-19242,z=18818..28322
+on x=-68634..-53973,y=-58009..-31614,z=-5131..5865
+on x=-16576..3952,y=63366..90574,z=8992..37515
+on x=-7386..14817,y=-14155..5703,z=66136..88553
+on x=19106..54924,y=-12140..15434,z=68415..80932
+on x=7336..31425,y=65432..82588,z=8047..29593
+on x=22525..33599,y=-68372..-39358,z=-68143..-43500
+on x=5213..21274,y=-39249..-27045,z=-91831..-72038
+on x=-31642..-16632,y=-2869..8672,z=66852..81506
+on x=70305..84886,y=-41625..-15439,z=-29089..-2340
+on x=-60096..-54846,y=-46888..-14091,z=-57849..-36369
+on x=-44911..-23725,y=-22548..198,z=55411..76767
+on x=-57512..-33022,y=-64054..-54691,z=22591..39559
+on x=535..39401,y=56745..78405,z=23560..28326
+on x=-56374..-39060,y=-77520..-41804,z=-7273..13316
+on x=7013..28554,y=32070..54196,z=47529..70955
+on x=-76288..-56876,y=-56665..-25593,z=-16778..-6302
+on x=-37510..-11747,y=61094..74622,z=-2370..18659
+on x=-58709..-30616,y=-33464..-11638,z=50961..72748
+on x=-55454..-27679,y=-82741..-59621,z=-9194..15631
+on x=13172..40388,y=11138..40063,z=-82760..-65315
+on x=14388..27772,y=-67554..-46788,z=-70583..-43179
+on x=15748..48411,y=-58853..-46690,z=45719..67485
+on x=-64826..-42121,y=-69677..-41462,z=-19124..10506
+on x=-38968..-4505,y=21318..56103,z=53808..76243
+on x=52992..73842,y=-45007..-30798,z=-40845..-17070
+on x=-72448..-52368,y=-13003..12727,z=-51653..-39744
+on x=-89717..-56812,y=-11429..11004,z=-33713..-29320
+on x=-82797..-68105,y=-907..18442,z=-48479..-36446
+on x=-52400..-36160,y=-2729..11358,z=-73134..-48314
+on x=-25713..-1239,y=45923..57024,z=-64104..-48955
+on x=-24274..3585,y=-91301..-60004,z=-36996..-8396
+on x=-72952..-55266,y=-33277..-2819,z=-34959..-11204
+on x=-66793..-46197,y=50987..54931,z=-27353..-16284
+on x=43392..52101,y=-14627..12623,z=-71060..-48522
+on x=-77723..-72809,y=6362..11492,z=9252..30717
+on x=32463..54093,y=18767..32223,z=-79630..-54627
+on x=26726..36372,y=-18434..723,z=54237..77721
+on x=62209..80598,y=-43071..-26185,z=11647..20283
+on x=-12408..8805,y=-82322..-75005,z=-7927..12271
+on x=66471..72381,y=-1981..28059,z=27987..48109
+on x=-80370..-49201,y=-61716..-49683,z=-30867..-7453
+on x=37596..66737,y=-68892..-60777,z=-33858..-8114
+on x=17321..30730,y=-52278..-42302,z=54029..68729
+on x=-77142..-71446,y=7200..27046,z=-14711..12602
+on x=-22544..-1958,y=-33075..-2255,z=-86145..-70682
+on x=55145..79591,y=-11592..16417,z=-30690..-11963
+on x=-13258..8815,y=64606..98004,z=-8762..6548
+on x=11099..20143,y=57055..77284,z=-23767..-18751
+on x=52489..83696,y=15746..31820,z=8280..43534
+on x=-66484..-41050,y=-57811..-31218,z=24204..41390
+on x=60564..85343,y=-27885..-15572,z=-28159..7052
+on x=-317..14600,y=68181..76576,z=-39440..-13155
+on x=-75121..-51737,y=-40321..-29860,z=15647..37621
+on x=-54204..-41260,y=5051..35207,z=53197..81544
+on x=36998..51680,y=51159..76975,z=5399..12759
+on x=-16863..16337,y=-80953..-58351,z=-59967..-35458
+on x=31744..60271,y=-14750..10965,z=49476..82924
+on x=-2256..18179,y=-73825..-67358,z=-34072..-25314
+on x=17732..43807,y=62479..77780,z=13938..28034
+on x=1622..28357,y=-82169..-57048,z=-25837..88
+on x=-40461..-9223,y=62104..86603,z=14710..22383
+on x=-81227..-61564,y=-42653..-23629,z=29983..44317
+on x=20880..48206,y=41863..67134,z=32598..46063
+on x=-96416..-62247,y=-18355..6029,z=-5981..7217
+on x=-57869..-30585,y=56288..73456,z=16646..22837
+on x=75450..92466,y=-20645..12847,z=-25402..-14103
+on x=-5465..14054,y=-35719..-4050,z=71849..89372
+on x=-61081..-25279,y=-66905..-48434,z=23859..40935
+on x=-7800..10807,y=71020..85725,z=-15915..7901
+on x=53985..76201,y=20582..53668,z=-1323..23345
+on x=-85787..-63425,y=27676..42137,z=-9285..-3133
+on x=48336..68487,y=-38490..98,z=41624..59831
+on x=-78012..-53039,y=30299..67166,z=19090..40584
+on x=5113..13878,y=-78897..-73837,z=11134..18475
+on x=41756..68743,y=-155..35498,z=50442..64705
+on x=-81270..-68840,y=-17576..-3690,z=-32135..-14787
+on x=8219..40862,y=8918..25218,z=-77252..-54208
+on x=39105..44578,y=66714..83921,z=15354..22292
+on x=46189..61321,y=43841..68088,z=19301..53413
+on x=-62770..-57542,y=-20733..14047,z=-67275..-32150
+on x=65480..84873,y=3073..19647,z=6345..23441
+on x=46867..47491,y=46506..52780,z=26672..40094
+on x=17013..41829,y=-11136..13219,z=-82179..-70797
+on x=-34036..-23731,y=33357..53053,z=51260..72738
+on x=31113..47177,y=-66933..-39151,z=-61354..-38916
+on x=34145..51166,y=-3683..10926,z=52987..77874
+on x=41954..65645,y=-56607..-45672,z=-4255..10356
+on x=-68089..-55495,y=46167..65284,z=-2384..10704
+on x=7890..33438,y=37201..73446,z=-61118..-42873
+on x=-7504..12073,y=-76259..-56952,z=29469..62400
+on x=13684..21664,y=-31197..-1820,z=68848..89615
+on x=-85435..-60015,y=-25411..-2834,z=-13167..8182
+on x=-76535..-58434,y=-29534..475,z=-33953..-16134
+on x=-59255..-45581,y=42904..53487,z=-44277..-36999
+on x=24422..52934,y=-69287..-47156,z=27348..40808
+on x=-77855..-49832,y=-40133..-15312,z=-44484..-35346
+on x=-41154..-18246,y=4608..24334,z=73408..80625
+on x=-49987..-14202,y=25483..46341,z=-72668..-53755
+on x=13538..18051,y=23397..42374,z=64790..80510
+on x=54955..79143,y=-54794..-41945,z=10831..26883
+on x=-18711..-1344,y=-66328..-31191,z=59213..66700
+on x=-42306..-25865,y=-84072..-59112,z=-10635..13499
+on x=-78607..-56882,y=28422..42754,z=-42069..-4658
+on x=70330..93330,y=3485..16587,z=-2226..11978
+on x=42999..75014,y=-73237..-35809,z=-16684..5008
+on x=14380..47360,y=-7768..2171,z=-75135..-69101
+on x=56578..76847,y=-38598..-29395,z=-32815..-15926
+on x=-12748..8540,y=15488..35223,z=54552..86464
+on x=3158..16552,y=-24454..1647,z=-80496..-74467
+on x=56473..73209,y=-3433..12083,z=-54506..-38799
+on x=51012..77530,y=30088..48866,z=8772..24396
+on x=17665..25364,y=39750..62592,z=46640..74482
+on x=-28714..-6773,y=9347..31266,z=73840..78208
+on x=8925..38027,y=59998..85715,z=-24137..-10466
+on x=53001..66549,y=-4287..21472,z=-73164..-44211
+on x=-54149..-45881,y=-28052..-10796,z=49458..62599
+on x=-21963..6658,y=66148..91598,z=-21298..6962
+on x=-11782..161,y=-91012..-60861,z=21515..30530
+on x=-76804..-69730,y=13746..32487,z=-23642..-13658
+on x=963..15271,y=-71045..-39328,z=-71381..-47851
+on x=67896..74688,y=-32914..-22017,z=12647..33400
+on x=12634..39919,y=-66590..-50495,z=50004..68679
+on x=8442..27410,y=9042..25167,z=68135..95195
+on x=-25776..-14278,y=-29280..-10089,z=69100..90070
+on x=64423..65336,y=3388..18317,z=-63336..-39916
+on x=35919..66955,y=14633..25424,z=55317..61335
+on x=-73286..-65915,y=-44128..-28250,z=22971..40421
+on x=15859..26558,y=-56047..-29767,z=42976..66388
+on x=-6917..5955,y=65260..87252,z=-24846..4318
+on x=-65972..-29473,y=32115..66783,z=35787..53459
+on x=-67248..-44667,y=33707..64039,z=-31788..-18880
+on x=45484..66247,y=38595..43467,z=4589..29393
+on x=13889..18349,y=66828..91044,z=14198..32527
+on x=54724..85550,y=-30589..-5424,z=35166..56213
+on x=-42965..-21638,y=-60889..-33965,z=43998..65167
+on x=-35930..-32769,y=-78331..-56047,z=-14735..9050
+on x=-24860..-8877,y=-80975..-43953,z=44660..63576
+on x=-14165..8370,y=-22173..-12379,z=57378..77093
+on x=71416..77554,y=-27428..6152,z=-49013..-27924
+on x=-93105..-68413,y=-35230..-13620,z=-20316..293
+on x=18417..29118,y=-86664..-54984,z=-36954..-22621
+on x=55918..67650,y=-41116..-22359,z=-41830..-26146
+off x=46522..78165,y=-65457..-45507,z=6815..36492
+off x=47885..74001,y=-31398..-10975,z=28012..47043
+on x=-91510..-71175,y=-16528..11618,z=-12499..8654
+off x=-84874..-61512,y=8619..38028,z=-54298..-34830
+on x=-83118..-51007,y=-45381..-31920,z=-23725..3021
+on x=10327..15960,y=-81856..-71010,z=-33630..-17410
+on x=23031..50754,y=-44713..-23633,z=-63299..-46320
+on x=-46257..-28480,y=-49238..-30841,z=47755..73142
+off x=20153..42123,y=-1222..5657,z=-77756..-63549
+off x=-61474..-57812,y=21117..35860,z=35705..60812
+off x=-79310..-66078,y=30244..44852,z=-9818..11212
+on x=71346..88869,y=-31928..-3884,z=-24256..-2336
+on x=-14150..11801,y=-57201..-51842,z=40079..61755
+on x=-40978..-28089,y=-42914..-23485,z=55939..67185
+off x=-23863..-13907,y=-536..10465,z=-90190..-61663
+on x=-5454..24659,y=-79999..-64557,z=27835..52330
+on x=72970..84571,y=10891..31328,z=-6227..5365
+off x=-29582..-11617,y=15192..35976,z=-79544..-70922
+off x=31030..48464,y=53376..61684,z=23041..44016
+off x=-10069..14806,y=35482..66322,z=-63854..-56881
+on x=53051..84557,y=-15724..16551,z=42287..54722
+on x=14308..26815,y=-13886..-3319,z=-79479..-57838
+off x=-59590..-50887,y=24924..38221,z=-57585..-33212
+on x=-63473..-31750,y=-64527..-52962,z=3041..21881
+off x=-31812..-7489,y=-22611..5463,z=-94027..-61918
+off x=-82927..-54190,y=-9326..-491,z=20413..40734
+on x=17422..42553,y=8312..32307,z=-71649..-69485
+off x=-78294..-58360,y=35412..45701,z=11726..40925
+on x=-21097..-3642,y=-8835..14381,z=-99475..-68222
+off x=-84402..-69432,y=-14573..10548,z=14300..22158
+on x=48734..68681,y=-34310..-26273,z=-52329..-23613
+off x=-35075..-15047,y=-46105..-25811,z=63394..85781
+on x=-86314..-54848,y=-46805..-24845,z=3445..37489
+on x=-63351..-50251,y=1886..23129,z=49969..56775
+off x=9515..27274,y=50806..72697,z=-49477..-25800
+on x=-35588..-13052,y=15904..42770,z=-81932..-66144
+off x=-46532..-36208,y=52000..73477,z=1265..25986
+off x=-87317..-63208,y=-17777..9520,z=-23859..-3922
+on x=-6728..4683,y=-95124..-75630,z=-29826..-12203
+on x=18636..43049,y=-80651..-64046,z=-24566..10269
+on x=34590..45757,y=-60461..-41469,z=-61769..-39386
+off x=69352..98422,y=4474..7247,z=-13318..-2831
+off x=-8443..8104,y=-47359..-17553,z=61091..78345
+on x=36926..56794,y=-55435..-27634,z=31804..55162
+on x=-43184..-19362,y=-73702..-61346,z=-50469..-12904
+off x=-12667..10577,y=9915..24867,z=-88319..-68574
+off x=-41812..-19280,y=-50846..-20974,z=-73207..-56898
+on x=25317..48114,y=45115..64793,z=-34388..-8697
+on x=-7572..26486,y=45477..70127,z=50627..71118
+on x=-65568..-53227,y=46928..71092,z=-13475..-291
+off x=-79123..-55369,y=-24021..-16788,z=17459..45068
+on x=26906..52136,y=17854..35117,z=-79712..-60188
+off x=73240..87023,y=-12287..13613,z=10048..23682
+off x=-2039..1086,y=20152..33227,z=72963..88128
+off x=-16444..-292,y=35253..51124,z=49972..79032
+off x=-31142..73,y=52811..81568,z=35320..52590
+off x=-45280..-38826,y=32419..56574,z=34445..72131
+off x=-76025..-59111,y=14..8694,z=-60123..-35050
+off x=-15911..3734,y=-23253..-9645,z=-88648..-77200
+off x=47880..75437,y=28421..53226,z=33581..53756
+off x=16705..55995,y=-22513..-5765,z=-79544..-52799
+off x=43351..73267,y=-30268..-23880,z=-69607..-39884
+on x=-49229..-24544,y=40180..60627,z=49877..77312
+on x=-67421..-46871,y=30102..60244,z=16607..38923
+on x=52711..81149,y=-10627..-8351,z=-48619..-22583
+on x=29102..45238,y=-70802..-50027,z=16042..39140
+off x=-87363..-61250,y=-1811..4566,z=-48295..-31466
+off x=52765..72819,y=-38051..-27751,z=22516..53729
+off x=-95898..-76590,y=-4285..-1522,z=-7096..27186
+off x=39546..65197,y=59713..74511,z=-14000..15914
+on x=27920..58905,y=-11677..424,z=-79346..-62053
+on x=-28804..-11775,y=72541..86610,z=-12598..7458
+on x=11013..13476,y=62070..76490,z=-39383..-17081
+off x=39439..48894,y=-72648..-38252,z=-48344..-12634
+on x=-70559..-52651,y=27489..46016,z=9134..42011
+on x=-20036..2910,y=-22525..-6028,z=-87710..-68411
+on x=-57816..-32833,y=51432..68426,z=-20978..2045
+off x=-79019..-59736,y=15304..30243,z=-45210..-32477
+off x=-90119..-75160,y=-24706..8541,z=-26255..-2577
+off x=-6777..14477,y=-71771..-33912,z=46706..60930
+off x=61137..75324,y=31584..49892,z=-26327..-14848
+on x=1100..22606,y=28697..54124,z=-81504..-52509
+off x=-71074..-58799,y=27675..44853,z=-58966..-20807
+off x=-71600..-42287,y=8542..25589,z=56065..61233
+on x=-45251..-35045,y=38191..54768,z=44757..67534
+off x=54620..79108,y=-56141..-42099,z=12070..29484
+on x=-13747..5593,y=-70633..-59152,z=35086..48154
+off x=-6784..14050,y=-65722..-55419,z=44065..49503
+off x=-2302..33895,y=7082..27279,z=-77945..-63272
+off x=-19701..-7304,y=-76198..-72082,z=28958..48047
+on x=12815..40193,y=37433..74447,z=-56868..-48723
+on x=16409..41021,y=-5541..8042,z=-75386..-63309
+off x=17361..35839,y=6486..33733,z=71504..85138
+on x=9825..32255,y=-68518..-48749,z=-80039..-57545
+off x=-62298..-50656,y=-1852..19142,z=44967..61407
+off x=-65488..-40004,y=-59621..-37464,z=-48950..-23715
+off x=-21676..-990,y=-79126..-51600,z=-55573..-22384
+on x=16547..46077,y=59890..75234,z=-23757..-11399
+on x=-87743..-69823,y=-36681..-16284,z=-11987..20192
+on x=-41729..-18632,y=-35288..-5409,z=-69092..-63322
+on x=40240..53567,y=51071..76567,z=-32328..-14382
+off x=-62904..-45149,y=32738..63897,z=-19593..-15038
+on x=21216..24135,y=-75210..-50944,z=-44984..-16166
+on x=-69562..-35055,y=58744..70823,z=-15501..-9281
+off x=-68150..-52172,y=26975..39630,z=-53507..-17045
+on x=51169..78842,y=11583..29490,z=29644..52457
+on x=-15373..4253,y=-97690..-61806,z=1940..31386
+on x=73779..78637,y=5371..23397,z=-27149..-10358
+on x=19250..44620,y=-7232..11656,z=-82542..-70642
+on x=39149..61967,y=-16335..12372,z=52676..65415
+off x=-23056..-4050,y=-38844..-16159,z=64555..74496
+off x=45322..60654,y=-64033..-45875,z=-6345..6738
+off x=54100..90830,y=-34444..-21517,z=5118..19759
+off x=-231..8241,y=-54245..-31025,z=62160..90247
+on x=-10127..-4636,y=-83774..-49558,z=30741..56326
+on x=-61249..-36895,y=58338..75723,z=-15361..7006
+off x=18751..41594,y=49217..65051,z=35222..37374
+off x=-19037..-9828,y=-67561..-45441,z=24792..52641
+on x=40827..72676,y=-15481..-1454,z=37617..66011
+off x=-64739..-34793,y=-25699..-17432,z=-67453..-38858
+on x=-18058..5742,y=-23939..-5488,z=-94889..-71764
+on x=35519..41049,y=-27602..-9277,z=49488..82039
+on x=9331..32089,y=-17498..8315,z=-80543..-76033
+off x=-34327..-11605,y=11327..29037,z=-77519..-64466
+off x=-71841..-43926,y=16818..21609,z=-69739..-45874
+on x=-56990..-48349,y=-68324..-43481,z=3016..7811
+off x=9304..25782,y=30245..56041,z=51315..85795
+off x=32607..48888,y=3690..28091,z=52295..84881
+off x=-2404..31293,y=58151..81212,z=-31998..-25149
+on x=-63323..-36977,y=54027..77083,z=-26641..8719
+off x=60302..80800,y=35514..54303,z=12123..40785
+off x=47486..64483,y=7507..25137,z=-73417..-59938
+off x=2177..22958,y=73828..91348,z=20624..37806
+off x=-68778..-38496,y=-15625..6286,z=50357..61804
+on x=42481..65067,y=414..25425,z=52357..76953
+on x=21032..42183,y=-46797..-14635,z=-74998..-57422
+on x=-57819..-39759,y=37245..65409,z=-31057..-9476
+on x=29358..58776,y=8103..20134,z=-73101..-67091
+off x=-26017..-15663,y=-53499..-40680,z=-81777..-63642
+off x=-75822..-54570,y=-54832..-37673,z=-36225..-20978
+on x=-30274..-12377,y=62717..73698,z=-51083..-18953
+on x=25463..45515,y=-79814..-55158,z=15540..44754
+off x=-58176..-42144,y=-44091..-18834,z=49801..63998
+off x=40488..54727,y=-80750..-51881,z=-8037..3647
+on x=66133..82929,y=-13321..9855,z=-45192..-21257
+off x=3029..23415,y=-78534..-62743,z=-50610..-16058
+on x=63368..74974,y=104..20701,z=37152..63545
+on x=40949..74694,y=-62178..-38585,z=2610..19835
+on x=-472..15977,y=64084..84976,z=-24559..2476
+off x=49194..76848,y=-47174..-24042,z=-33508..-8663
+off x=67399..78692,y=-28620..-16523,z=-19377..4508
+off x=56630..74700,y=-14438..20792,z=36581..74432
+on x=21015..41464,y=-9104..15645,z=-88506..-73629
+off x=-43920..-26879,y=14492..28620,z=59594..70987
+on x=-35951..-21806,y=7254..24763,z=54493..72173
+on x=3336..22348,y=-15737..-3592,z=60764..78216
+off x=56117..66807,y=20737..31533,z=-44715..-23712
+off x=13306..42710,y=68250..78199,z=-32910..-17468
+off x=-87878..-53833,y=18415..53070,z=-16577..2999
+on x=33630..50999,y=-67779..-48804,z=30503..55076
+off x=57002..86011,y=-10279..10607,z=19904..42650
+off x=18927..33193,y=-16636..-1801,z=-88904..-63937
+off x=21167..45110,y=-67846..-46840,z=-67041..-43159
+off x=15448..29805,y=-69142..-47763,z=-56592..-41006
+on x=-31981..-15095,y=-20248..3871,z=63022..87403
+off x=-50574..-43927,y=-45935..-22203,z=-54205..-39534
+off x=23509..30725,y=-59187..-39824,z=-55008..-29804
+on x=-6893..10692,y=-4433..17662,z=-79958..-63043
+off x=52839..82867,y=-54135..-43532,z=5074..22443
+off x=-19801..2279,y=-45316..-18060,z=-73077..-53175
+off x=-34124..-23489,y=-77318..-57778,z=-10644..21309
+on x=-62168..-39417,y=46644..71553,z=-12633..-2688
+on x=-50071..-22810,y=-45081..-19082,z=-71537..-54243
+on x=-3347..16680,y=71919..95169,z=-26699..-14243
+off x=-57262..-44366,y=32309..66254,z=-33394..-21315
+off x=71646..96656,y=-8202..21856,z=-6535..-796
+on x=-27944..-5589,y=47496..68996,z=51465..59779
+on x=8322..20036,y=-71459..-51821,z=28654..53172
+off x=-1130..11235,y=-72111..-54015,z=38692..55881
+on x=-69102..-39230,y=21462..55716,z=-47827..-41441
+on x=51340..80906,y=-52377..-19741,z=-34853..-23124
+off x=-37865..-22986,y=-62050..-50913,z=-69238..-43924
+on x=28721..62342,y=-8593..21244,z=52533..83625
+on x=52746..80495,y=22003..40732,z=-40093..-20844
+off x=35892..47834,y=-67866..-46589,z=34299..53539
+off x=18277..20309,y=-15322..3925,z=-94574..-68257
+off x=23509..40977,y=-81126..-48154,z=-21..33400
+on x=13627..46617,y=-2537..25688,z=-74686..-56092
+off x=4445..25422,y=1276..13484,z=-78843..-67185
+off x=-12411..9686,y=-80652..-50914,z=-61600..-42810
+on x=-18060..-1885,y=16610..43651,z=67414..76707
+on x=30774..44990,y=-6499..11812,z=-87416..-59474
+off x=-59552..-40954,y=48890..63902,z=-39700..-21599
+off x=12390..31538,y=65013..80718,z=-15195..9149
+off x=-82717..-58814,y=9792..34867,z=31729..41188
+off x=-62226..-36572,y=-17931..-2307,z=64240..74646

2021/inputs/23.txt

@@ -0,0 +1,5 @@
+#############
+#...........#
+###D#B#A#C###
+  #B#D#A#C#
+  #########

2021/inputs/24.txt

@@ -0,0 +1,252 @@
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 14
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 1
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 15
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 7
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 15
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 13
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x -6
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 10
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 14
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 0
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x -4
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 13
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 15
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 11
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 15
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 6
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 1
+add x 11
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 1
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x 0
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 7
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x 0
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 11
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x -3
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 14
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x -9
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 4
+mul y x
+add z y
+inp w
+mul x 0
+add x z
+mod x 26
+div z 26
+add x -9
+eql x w
+eql x 0
+mul y 0
+add y 25
+mul y x
+add y 1
+mul z y
+mul y 0
+add y w
+add y 10
+mul y x
+add z y

2021/inputs/25.txt

@@ -0,0 +1,137 @@
+>.v>>....v...v...v>...>>>...>v.v>.>.v>...>.>.v.>>>>.>.>.v>>v.v.>.>>vvv....>v.>v....v>vv.v.vvvv>>...>v>v...vvv>>>>..>v>...v>v..vv.>.>..v.v>.
+v.v.>.vv..v.v.>.......>.v.>>......>.v..>..v..>.vvvvv>v.>>vv>...vvvv.>>v>v>>v...v...v>.vv.v>.>.>..>>....v..>..vvv>.>vv>v....>>>v....>.vv...v
+..v...>vvv>>......>>..v.v..>.v.v>....v...>v>v..>>v>......>..v.>.>.>.v.>v>v..>.vv>.>...v.vv....>>>..>.v.v>..v...v.>v.>..>v>.v..>>v>v..>>>.v.
+.>vvv.>.>>>.v..v.>.v..vv>>>..v...v...v>v.>........>>>.>.v..vv>...v.v.vv>v>>>..>>>.v.vvv..>v.vv.v>..v>vv..>.>....>v>vv....v>...>v>v.>>>v>.>>
+v...v.v.v>.vv>>...vv.v.>v>.>..>>>>...>>vv>.v.>.>>vv.v.>>.>v.>vvvv>v.vv>>.>>.v>v..v.>.>...>>>>v.v>..>.>..v..>vv...v>vv...vvv>>.vv.v.v>.v...v
+>>v...v.v.>v>.>>>....>.>>v.>....>>>>v.....v>..>v.vv>.....>..>..v..v...>v..>v>..vvv>.>..v.vvv...>vvv>.vv>..>.v...v....v.v.v>.v.>>.v.v..>v.>>
+>v....v>>>........>....>..>.v>>....v..>...vv>v...v>.>>..v...v>>.......v>..>>.v......vv>>v>>>v.>v>.....>..vv..>v.>>..v.v..v..v>.vv>>>v>>v>vv
+v.>v.......>...vv..v.v>>v.v>....vv.v>..v..>..>v..>v..v..vv.vv.....>>>....>>v>.>....v>.>.v>...v.>v..v.v..>..>.vv...>.>v.....v.vvvvv..>.>v.>>
+>.>>..>.vvvv.>.vvv.vv.v>v>>vvv.vv......>...v.>.>vv>>..vv>v>..v>v>>..>.v..v.>>...>.v>>v.v.>.v.v>v>....>>...vv.v>..>v>.>>.>........>.....v>>.
+>.>v.>v..vv..v>v.vv.>v....>>.v>.>.vv...v>v.>.v>>vv.v>>..>>vvvv..vv>>.vv>.>>...>.>>..vvvv>.>>>.v.v.>>>v..>>..>.>>....vvvv.>..v>v.>...v>...vv
+>..v.>.>...>v>..>.......>vv.v.>>>.v>..>>>.>.>v...v.v>>>>>v>...>v>..>..>.v.>.>.vv>>v..>v>>.vv......vvv....>>>>v>v.....v.>v>.....>>>..>...>..
+.v..>>v>.>.>...vv.v.>vv...>.v...>>>.>..v...v...>>v>.>...>.>.v>v.v.>..>.>...v.>>.v...v..>.....vv..vvv.v.>..>v..>v....v>v...v.....vv..>..v.v.
+..>.>v..v.....>.>>v.>.v>.v>>>.>..>vvv.>.>....>v..v.....v>..>..>>..>v>v.>.v..>.vv.>...>.....v.....vv>......>..vv.>.vvv.v.v>v>v.>>.>>>>...v.>
+v..vv.v>v>>>..>...>...>vv.>.v.>vv.....>v.>>.>...v.>>...>vvv>v.v>v>v.v.>.......vv>.v>>.vv>.>.v...>..vv>v>..v>>>.....>>...vvv..>vv........v>.
+..v....v.>>>vv>.>.>>...>.>.v.v..vv......v.....>>.....vv>.vv.v>v..>....v.vv...>....v............>>.>>v...v.>.>>v>..>>>.....v.v..>vv>..v>>...
+.>v.vv.v.vv.>.>..v>.v...v....>>v...>v.....v.....>>.vv>v.vvv.v..vvv.vv>v.>..>>>v..>.vv...v..v>.v>>>..>>vv..>.v>.vv...v.>>......>..>...vvv.vv
+..v....>v.>>>v..vv>v..>....v.>.>v..>v..v.v>v.v>...>>>.v...vv>v>>>.v....>.vv.>v...v.v.>v.>vv.v.vvv.>v...v...>.v.>..v.v>>.....vv>>.v>v.......
+....>>vvv........>v.>.v..>.vv.....>..v..>..vv.>>...>.v...>v.>..>.>....>>>>.....v.v.....>v>.vvvv>.>v..>.vv..>vv>...v..v>>...v..>..v.>.v.....
+>v>v>>.v....>.v>.v>>..>..v>>v...>.>>>v...>>>vv....>..>.v.v.v..v.>...>.v.v.v.v>.>v...v>.v..vv....v.>...>v.v..>v.v..>...........>>>..>.v.vv..
+..v...>.>>.v>>.v.v>>.>..>>.>.......v>.v>vv..v.>.v...>v>..v...vv.>...v.>.vv.>..>.v>v.v.>..v>..>..vv>v.v.v>...v>v..>v.v.v.vvv..>v>vv>...vv.>>
+>.v>.v.>.vvv....v.v....v..vv.v.>>...v...>.v.>.v>v.>v.>.>>>..>v.vvv.v>.>v..>>...>v>..vv.....v.v..>..v.v>.v>v.....v.>vvvv.vv.v.>vv.v..v.>.>.v
+.>v>v>.v>>v..v>>v.v>..>v..>>.v.v..>..>v.vv>..>v>v.>.vv.>>.v....vvv>...v..v>.v.>.v.v..v>.v>v..>.>..v.v..>...vvv.>.vvv...v>v.....>....vv>....
+.v>.v>.v.vv>..>....>v......vv..>.>v.....>v>>.v>.......>.v.vvvv..>v....>.v..vv.>v.v..>.>.v>v.>...>.>..vv>.>>.....v.>>v....>...>>>v..v>v>.>..
+v>.v>>vv>>vv........>v.>..>>v..v.........v.v.vvv.>v>vvv>.......>>>....>>>v..>>..>>>.>......>.v>v..v.vv.>...v>>v..>>>..>.>vv...v>.>...vv>.v.
+.>...v....>.v>..v.>.vv>.>>v...vv.>..>>v...v.>..>>>vv..>.v.>.v.>.vv>.>>>>.vv>.>v..v>...>..v.v.v.v...v...v>>..v>.....v.>..v.v>.v.vv..vv.v...>
+.>..v>>...>v>.v>.>>..>>.vvvvv.v>v....v>v>....>v..v.>>>..>>vv..v>.v..>v>..>.>.v.>>>v...v...v>.v..v.v.....v>v..>.........>.>vvvvv>>vvvv..>...
+>v>......v..v..>v.>>.....>>.v.>..>.>>v.v.>..>.>.>.>v.>..>...v>>.....v.>>......>.>.vvv.>..vvvv..>.>....v..>>..v.>.>>..>.v...>..v>v>>.>....>>
+>v..>>.>v.>>.v>.>.>.>v.vvvv.v...>.....v....>>v.>vv>.>.>..v...>v>v.v.vv.>>.....>>...v.v>>v.v>.v..>..v>v..>..>.v.v.v.>.vv.>>>.v.v..v.>vv.v.>.
+v.....v....>>v.v.>..>..>>v>vv>.>v>>.>.vv..v..v>.>.v>.>..v>...>.>v>...v..>>vv...>.>..>v.v>...vvv.v>.>...v>v.vvv>v.>...v....>>>v>vvv>>>.v>...
+>.>>.vv>.v.v>>>.v>>.v....>v>......v...>>..>.v.>..v.>>.v>..v....>.>.>.v....>>>..>..v>.vv>..>v...v..vv.v...vv>.>..v>..>..vvv.....>>....v.>.vv
+...>.>.v>....>>v....v.v.>>v>v.v..>v.>>>v..>..>..>v.>.....v.v.v.>>...>.vv..>..v.>vvv...v>....>.v>v>>v>v..v..>.v..vv>..>>>.vv>vv.v>>.v.>>...v
+.>vv.v...>.>.>..>v.v.v>v...v....v>vv>>.>>.....v>>..v.v>.vv>.v>>vv..>v...v..>v>..>.v..>vv>..>>.v.>.vv>vv.........v>.v........v>>v..v>vv>v.>>
+.....>...vv.>.v.v..>vv.>.>.>>>..v>...>v...>.>>>.v..>>.>...v>>.v.v.v>>v..>.>>v.>vvv.vv>.>v..vv.>>....v...>v.......v.v.>.>.v.>>.....>v.....>.
+v>.>v.v>>.v.>vv.vv..v.>v.v........>vv.v>.....>v.>.v....v>.>>..v>.vvv...>.vv.>......>v.>.>..>v>.>..v..>..>..>.>..>>>v.>v.v.>..v.v>>>vv.>>>v>
+v>v....>...>..>v..v>.vv..vvv>>v.>.>>..>..v....vv..>v>v...>>>.......v.......v.v>....v>>>..>v.vv..v>.>>.vv...vvv.>.>>>>.>.>.>.>>....>>.>>..>.
+.v.>..vv..>.....>v.>v.>>>v..v>.v>....v>>...>..>>>v>.>>>.........>.>.v.>..v>..v>..vv>.>>v.vv....v>>.v>..v.>.v.>>...>...vv.v.v..vv.>>..v>v..v
+v>v>.>.v..>v>>.>>.>.>.v>>....v>vv>vv>..v.........>.>.>....v>vv>vv>..v.vv.......vv.vv>>v.v.v..v........v...>v>.>.v.vv..>.>>>>>....v.v...>>>.
+....vv..>..v>>..v.....v.v>v.>...v>>..>.>.v..v>.>>vv...>>..v.v>.>...>..v.....v>>vv>v..>.>..>.>....vv>..>.v...>.v....>...>.>..>.....vv>v.>v.v
+.>.v>v..>>...v.v...>...v>.v...v>>.>>....v..v.>.....>>...v.vvvv...vvv.>.>v>v.>>vv..>..>>..v>v.v>.>.v.>>..vv.>.>vv>vv.>.>.>..v..>..v.vv......
+vv.v.>v.v.>v>>.>....>v>>>vvvv..v.>........>vvv..>..v.....>...>.vv>..v.>v>..v.vv.>>>.>v...>.v>.....>.>v..>...>>>.>v.v..>.v>..vv..v>..vvv>..v
+.vv>>v>......>.>....vv>..>>.>.>v>..v...>v.>vv..>.>>v>...v>..>..>>>..v>v.v>.v..>v..vv>.>.>..>>...vv>..>v>v.>...vv..v...vvvv..vv>.v..>>.vv...
+.v.v>.vv....>...>..>>..>v>.>...>.>>..>.v..v..v>.>v...>>>.vv.>....v.v.v.vv>>v>v...>..>.v.v.v....vv.>>.>vvv>..>...vv....v>v>..>>>.v.....v.>>.
+v.>..vv>v>v>>>....>>....>>v..>..v.>.v.>vv.v.>.v>..>.>>>.v..v>>>.....>vv.v.>>vv....>>>.v>...>v.v.v>v.vv.>....v>>v>...>.v>...>v.v.>>>.vv>.>v>
+v.>...>>.>v.>>.>..v.v>..vvv.v....>>>vv.....v.v.>>v..v..>..vv..v>...>>.v>v>.>..v.>..>v..>.....>>..v>>v>>>v..>v.v>.>...v..>vv>v>....v..>>>>>v
+....>.>v>.v.v.>.>.vv>v.v>>>.>...v>v.....vv....v..v.v..vv>>>.v.vvv.v.>..v.vv.v...vvv>..v.>.>.v...vv>.v>.v.>..>vv....v>.>..>v.>>>v.>.>....>.v
+>>.>>>.>.>vv>..v.>>...v.>....v...vv..v>v>v...v>>v...v.v.>.....>.>>>.>v.v.>vv...v.>......>..>v.>vv.v>v.>...v>>..v.>v>.>.v>v..v.v>.vv.>....v>
+v..>...v.v....>.>.vvv>.......v>.>v.....v>.>>vvvvvv.v..v..>vv..v.>v..v...>.vv.>>.v...v.vv>..v>..>...>vv>>>...>>.v>..vv..>.....v>v>...>vv.v>.
+.vv.>v.vv.v.>.>...>v>..>>..>v.v.>>...>v.>>vv>vv..v..>>..>>.v.>>vv>v.>.vvvvv.v..>>>.vv..>>>>>..vv>...vvv....v>vv.>v..vv.....v..>>...>>>>..>.
+...v>.v..v.>.>.>.v>>.....v.v>.v.>v.v.>.>>>.v>.v>>.vv.>..v.v...vv.>...>.>v..>v....v.v>.>.v..vvv.v.....v.vv..>..v.>..>..v..v>.vvv>>.>..>.>>>.
+...v.>v.....>vv>v.v>...>vv>>..>.v.>..v>.v.v....v.>.v>.vv>.>..>..>>.v>..>v..>.v>vv.vvv>......>...>.>v>>>....>.v.v.v.v..>.v.>>v>.>v>.>..>v..v
+v>.v.vvv.v..>.....vv.v>..>>.....v..>.>...>>..v.v>>.>..v....>v>.>v..>.>....>>...>...vv>v.>>vv..>....>v>>v..v>...v.....>>.....v..vv.v.>>...>v
+v.vvv.>>.vv....>..>v...>>.v>....>v...>.vvv.v......vvv.>vv..vvv...>..v.>.v..vv.v>....v....>.v.v..v>.>...v>v>>>.vvvv..v.vv..>vv>.>v...v.v>..>
+vv.>....v...vv>.v...vvv.>>v.v>.....>...v>>.>>vv..v.....>vv.vvv>>.v.>>.v..v>>..v>.v.>v>.>.v.v.v..v>>>vv.......>>...v>vvvv>v>.>>v.v>.>>v.>..v
+v...>.vv..>v..>...>....vv....>.v.>>v>.......v...>>.....v....vv..>v.>.>..>...>>...v.v>v.>.>.....>..>.>.v......>.v.v.vv.>.vv.vv..vvv>vvvvvv>v
+vv.v>.>v>v..v.v...v.vvv..>v>.v>.v..v>v>>v>...>v.vv..v....v..>..v...vv>>.v..>>.>>v>..>..v.v..>v.v...>>.v>>.v>..v.....v.v.>>>.vvv.>...v.v...>
+v...v.>v.....>..>v>..>.>>>.v..>.>..>>>>>>v>vvv.>>vv.>>.>..>>v.>.v......v.>.v.v>v...vvvvv>...>.>.vvvv.....v>.>.>.>vv...>..vv....>v>>..>.v>..
+vv>..v...>.>...v..v.v....>..v>>...>.v>v.>...vv....vv.>...>.>..>>...v>..v>...>...>v..>>...vv.vv.>v...v.>>......>.>.>v>v...v.>...>.v.>.v.>>>.
+>...>.>.>>..v.....vv.v...>.>>..vvv.v.>>vv>...v.>...>.>.>v...v>.....>v>v>v....v..>>....vv..>v>v...>>v.>vv.>v.>..>....>...v..>.v....v.v..>v>.
+vv...>v.v>v.v..>>.>>>vv....v.>...>v.v.>>>v...vv..v.v..v.....>v..>>.>..>.v>.>>v..>vv..vvv>v.vvv..vv.v>....>>>>>.v>....>>>..v.>.>.v>......>>v
+>>.vv>>.>>...vvv.>.>.>>.v>.vv>..>..v.v>.v........v.v>vv.....v.v>v.v.v.v..>>..>v.>.vvv..>>..vv..>...v.v>>.v>....>>>>v.>v>vvv........v.....>.
+..>..v..v>>vv.>.....v..v.v..vvv.vv..>vv>..vv.v.>v>.>>>v>.v...v.v.v.v..>.v...>.v.vv>.vvv.vv>.v....>....>..>.vv>>v..v.v.>>....v.v>.v..v..v>>.
+.v>.v>>.....v.>.>v>.>..>>.vvv....>..>>>..v.v.>.>...>v.v>.vvv.>>.vv>v.>.v.v.>...v>vvv.>.v..>v..v>.>>.>>....>v...>..v>.>..v>..v...>v..v.>v>>v
+v.>.vv.v>...>v..v.>.vvvvv.v..>...>...vv>>..>>>vv.>>v>>>.>.>....vvv.>vv>..vv..>.>>.>>v>.vv..>>.....>.>>..>..>v..>..>>.v>>...vv>>.>..vvv...v.
+>>..>.v......v....>>.>...>>.>>..>vv.v>>.>.vv.>v.>v.>v..v>..v.v>.v.>v.>>>...>.v.>v..v..>>.v.v.vv>..>>v.v.v>...v>>v>>..>...v.>.....v>v>.>v.>>
+.v.v>>>>>vv>>.>.>>>.vv..v.>...v.>..>>v.v.vvv...>.>..v.>>.>>.vv..>>>>.vv...>.v.vv.v..v>v>>>.v>vv.v>..vv..>v..>v.>>..>v..v>.>..>.>...v>.v..vv
+.>.v...vvvv..v...>..>....v.>...v>>v.>v..v>v>..>>>v>...>..>vvv.v.>.v...>v>.v>>>>v...v.>v>....v.v>vv>.vv>.>>v..>...>vv...>.>v.>.vv.>...>v...v
+>.v.>.>...v>.v..>.v>>.>...v.>>..v.v>.v>.>vvv......>..>.>v>....>>.>v.v...v...>>>>.>..>...>.>v>.v..>...v..>>.v..v>.v>v...>v>>..>..v.>.>.v.v..
+.v.>>..>.>.v.>v..vv>>..>.>.v.>.>.v..vv..>...v..v.v>...>v..vv>.>vv>.vv>>.>>...v....>..>vv>>>.>.v>..v..vv>v.....>..>>......>.>>v>>.>.>v...vv.
+....v.>.>>>v.>....>>>v..v.v..vvv>.>v.>v..v..v.>>.....v.v..vv...>v.v...>>.>.v..>.v....v.>v.......vv....>.>v>vv>>..>v.....v>...>..>>>..v....v
+..>>>.....v>.v>v.vv>>.vv...>>.....v.>..v>v.>v>>.v..vv......>v.v.v.vv>>..v>v.v>..v.>.vvv.>.>>>...>....vv.>v>.....>.v.>..v..vv.>.>...>v>v.>>>
+...vvv......v.....>>>.....>.>..>.v.>.......>.>.v>v...>.vv>.>...v>.>>.>.>.>>.>vvv...v.v>>>>..v>..>>v..v.v.v..>.vv..v>v..v.v.v......>..vv.v>.
+v.v.v.v..v..vvv......>vv>>v..>>>>>v>v>.>.......>.>.>..>>>...>vv>.>.>...>..v>>>>.>.>v.>vvv...>.>..v.>.v...>.v>>vvv>vvv....v>>.v>.v>.v>....>.
+>>vvv.>>..>v.v...v.>v....v...v>>.vv>.vv..vv.v.v>vv.v.........>..v.vv>v>>>v....>...>...>vv.>.>.v>v..>>..>v>.vv..>v.>>>>>...v>...>vv>.v>.v..>
+>....>.v..>.>.>..>..vv...>>v>vv.>>.v>>>.v....>>>.v.>.v>.>>.vvv..v>>v.....>..v.v..>.vv.>....>>>v..>.v.>>v.....v..>>...v>.>>...>.v...>.>.v>>.
+v>.v>..>v....v.>>>v.v.v.....v>....vv...>v..vvv..>..>vv>vvv...v>>.vvv..vv>>v>.v...>.v......v>>...v.v....>..v..v>.v>...v.>.>...v.v.vvv..>>..>
+>v.>.......v>....v.v.>vv>..v>>.v.v.vv.....v........>.v...>.>.>>>v>....>vv>...>v.vv..>.>>v.>.v.>..>..v..>......>>>v>vv....v....>.v>.v.vv.>v>
+.v>..>..>.>...v.>.v>v..>.>.>.v.>>vvv..>.....v>.vv>v.v.v..>.v..........>v...>.>>.v>>vv.>...>v>..v>v>.>>>.>v.>.>...v.v.>v..>..v.v>..v.>>.vv.>
+..>.>v.vvv..v.v......>>>>>...>>v>....>v.>vv.........>>vv.vv.>v>...v>.>...vv...>v.>.>vv>....v...>>v>>..v>.>v.>vvv.>>.>v>..v.v>>....vv.v>>v>>
+>..>>v...v..>v.>..vv.>...v.>>.v.vvv.v..>..>>.v.>....>.>...vv.v..>>.v.>v....v...>..>.v.v>vv...vvvv>>v..>......>..v...>..v..>>........v...v..
+>v..v.>>......v.vvv.........>>..vv>>vv.>..>v....v.....>..vv..>.v.vv..>>.vv..>>.v.v..>..vvv>>....>...v.v..>v.>>.v.>>>>......v..>....>.v>>v.v
+.v.>>..>v>>.>...>>..>v.v.v>>v.>..>v..v>>.....>.vvvv>.>....>>.vv..>.>v.>.>>.>>>>..>.>vv>.v>..>.>vv>vvv..v>...v>.v>>.>..>>..>vv>v>.....v>.>v.
+>v.v..vv.v......vv..v>>....>>>.v..v>v.v>...v..v.v>.>.>..>v>>v>>>..>>v.>...v>>...>.vv.v.v..>..>.v>...>..v.>v...>.v.v>.>>vv>.vv..>v..>>v.vv..
+...>v..v.vvvv>..>v..v>.vv....v..v..v>vv.>.>v>.v..>.vv>>vv.v.....v.....>.vvv.vv>.>...>v...v>>.vvvvvv.v>......vv.......v..v...>.vvv.vv..>>.vv
+.vv.>v...v>>.v...v>v.v.vvv.>>v.v.v.....v..v>>.vvv...>v....>vv..>..>.>vv..v..vv.>vvvv.>>>v.v.vv>..>...v>>.v.v>.>>...>...>v>>vv...>v.>.vv>...
+>>v..v>>>v>v>.v.....>...>v.>.v.v.v..>.>.>...>.vv..>..>>...>v>.v.v.>.....>>>v..v.v..>v.v.v>v...v.>...>v>>.>...v>...>.>.>...v.v.v.....vv.>>>v
+.v.......v.>v>>.>>v..v.v..v>..>.>>..v....>>.v>.>..vv>>v..>v..v...>...>.....vv.v>...>.>v..>.v.>...vv....v...v..v.vvv.....v...vv...>>>.>v>.>.
+>>v.....vv.v>.v>.v.>>.vv>.v...v>.v>>v..>>v.>.>>v....>..>v>>>.>..v.v>..>>v>>.....v>.>v....vv.v.v.v.vv.>>>...v.vv>.v>...v>vv>vv..v.>..v....v.
+..>>...>......>....>v.v.v>.>...>>vv.v>>>.v.v>.>>>vv.v.>..>...>...v.....v....>..vv>>...vv..v..v>.v>.v.v..v...vvv..........>.>v.>.v.>v>v.>v>>
+..v..>>>>...vvv.v....>..>>...v>.>v.>v...v.>.>.v.v>.v.......>.>v.>.v..vv.....v.v.>.v..v>>...vvvvvvv...v....v..vv..>>..>>>..v.>vv>..v.>>>vv.v
+vv>.>.vv.v.v.....vv>>v..>v..vv.>>.>.>.v..v>v...>...v.v>>..>.v......v.>>.v.....v......>......>v.>v.v>>>v..>.v>..>.>v.v>..>v.v..v.>.>.>vvv..>
+>.v.......v>..>.vv>v....>v..>v..vv.v>>v>..>.>>..>..>..v.>v.....>.>>v....v>..v>...>v..>vvv.....vv>v>.v>vv.>v>>.vv>>.v.>.>...vv.v>vv..>.v...>
+vvv.>.>.>...v.v.vvvvv>.vv>.>...v.>.v..>.>...>v..v...>>vvvv.v>.v.>.vvv...vv.vv.>>.>.>.....vv..vv..vv>>>>.v>>v.>v.v.>>.v..>>v.v>..>>..>v>....
+v..>...vv...v>......v>...>.....>.>.v>.>vv>v>......>>.v..>.v.>..>>..vv.>v>.v..vv.v..v.>..>v....>..>.>.v.>>vvv..>v.v>v>v..>>.v.>v.v.>>.>>>v..
+v.........>>v>vv..>.>..>>>.v>...>v...>>.vv.v>...vv...v>>..v..>>>>.>v...vv.>vv>..v.v>...>v.....>.v>>..v.>v>.vvv.>.>v..v.>.v....>>>>.v...v.v>
+>>.>.>>.vv.>v.v.v.v>v....vvvvv..v.v>>>..>>.>..v>vvv>v.>v>>v>>..>>>>.v.v>.>.>.>>v.v.>v..v.v>>..vv....>....>>.>.vvv>.vv.....v>v.>>vv>v.v.v..>
+....vv....>....v>v>>...vv>>>.>..>.vv>v>.>>.v>vv..v...>>v..vv..>.vv.v>>>.>.v.v>.>.v>>...v....>.........>.....v>...>.>....vv..v>.v.>v...v....
+.>v.>.v>>v...>...>.....>.v>..vv>v>.vv>..>.v>.>...v.v.v.v.>v..vv...>...>vv.....>...v>v.>.>..>..v..v.v>.v..v>v.>v..>>...v....v.v>..vv.v>...>v
+>vvv.v>..vvv>.v>..v>.vv.v>>>vv......vvvvv>>.>v>..>vvv.v.vv>vvv....vvvv.v.>>.v>>..v>..v>v>.>vv.>...v.>>>v.>.>..>..v>>..>..>.v>>.>..>..v.v...
+.>v>v....>.>.v.....>v.v>.v..v>vv.vvv>.>..>vv..>..>v.>>...>.v>.v..>v..>.>...>..>...vv...>.>>v.>.vv>>....v.>.>.>vv>...v..>.v>v>v>...>v>....>v
+.>.>...vv.>>>...vv>.v..>>>..>.vv>v..>v.v....>>v>.v.vvv...v>...v..v>.>.>>>>>vv..v.>..v>..>vv>.v>>...v>>.>v.>.vv>.v..v..v...v>>>.v.>.>..>v>.>
+.>>v.vv.>>>>.>vvvv>>.>vv.>.vvv..>....v.>..>.>.v............>>...>>>>>.>.>>>...v..v.>.>.>..v..>.v>>.>v.>..v.>v.>.....>..>>>>v.v..>v>.>.>..>.
+.>v>.v..vv.>..v.v.>vvvv..>vv.v.>.v>vv>....v.v...>>..v>.>.>..v..v>.>>>v.>>>v>>...v..vv.vv.vvv...>..>..v..>>...>v.....v>vv....vv....vvv..>>..
+>v.v.vvvv.v.v....v.>>v....>>.>..>...>.>v>.....>v>v...>>v>...>.>..v.>v>>>..v..>.vv.>>>vv.vv.>v>.....>v.>>.v>.v>vvv.v...v....v...v....>v...v.
+v>>>v>>>.vv>vvv...v>v..>v>.v>..>.v..v>v....>.>>.v.....v.>>....vv.....v>v.>.>v...>>..>>>.>v.v.vv.>>v..v>vv.vv..>..>v.....v>>v.>.>>...vv.v...
+>vv.>.v>.>>....>v.>.>v>.>..>.v.vv.>>>>..v>v>vv>>v....>v>>.vv..>..vv>>v....v.v.>>>>v.....vv.v>>.v>....v..>..>>>v..>.>.>>v>.vv....vv>v>.....v
+..v>.v..>>vv>......>>.>...>..vv..v.v>>.>..>>..v>.....v>..v>>v.v.v.>>v..>v.>>.>vv....v>v>...vv>>>.v>v.v>.>..>v..v>.....v.>>.>v..>v>vv>>>..vv
+...>>>>>.v.v>..v.....vvv..>.>...vv..v...>.....>v.v..v..v.>v.vvvvv>v..vv.....v>.v.>.....>...>..>...v.>>v>..>.>vv.>>v.v.vv.v.v>..>.....>v>>v.
+vvv.>...>v>>>v...v.v.v..v...v.>>..vv.....>vv.>..>...>>....>>....>vv.v.>v...vv.vv>.>v.>v.>.>>...v>.....vv..vv.v>vv..>v>>>.>..>>>.vvv...>....
+..v>.v..>..>....v...>....v>v>v.vv..>>>.v.>.v..>..>>>..vv>>>.v>v.v>...>.v.>>.>.>...>.......v.v>>>.>...vv.v.>>.vv>v>v>..v.>v..v.>..>v.>..>v.>
+..>v.v...v>...>..v>...>>v>>>>>>.v.>.>.....>.v..v>v...vv.....>v.v.vv..>.v>v.>.>>>>>v.>>.v.v...v>v>>.v>..>vv>.>.vvv>v..>.v.>v>v>>..v>........
+...v..v>..vvv>...v>...vv....>..>...>...>v.>>vv.>v.>v...>vv>>v.>v......>...>.>..v..v.>v>>.>v>>>...vvv.vv.>..>..v..>>>vv..>...vv.vv>>...>..>.
+>.v...>>>>>>vvv..vvvvvv.vv..>.v>.v.v..vvv>v..>v>.>vvvvv>>..>.vv...>.v....>>>...v.vv..>......v..>..v.v....v....v.....>.v...v.vv>>..>..v..v.v
+...v>v..>.>..v...>v>v....>vvv>>>.v>>...>....vv>v...>v..>.v.>....v..>v..>.>v>.v.>..vv..v.....v..v..>....>.>.>v.>vv.vv.vv.>>v...vv.....v.>>v>
+v..vv..>...>.vv..v.v.....vv..>v......>v...v>v..v>.v>...>v>vvv>...v>v...>v.>>v......v>.>.........vv>....>vv>>v..v.v>..>vvv..>vvv..>.v.vv...v
+v.>v.>..vv>..>.....>>>....v.vv.v...vv.v.vvv..>....>>v>v>.>.v>>>.>.>.>...v.v...v.>v..v.>v>.vv.>>>.v.vv..>v>.v>..>vv>>.v>.>v..v..v>v>.>.>vvvv
+..>..>>......>.v>>>>.>v>..>.v....>...>>.v.v.vv....>.v>.>v.>>.>>v>.>..>vvvvv.v.>.v.v>.v>v.v>..>v..v.v.>v>>.>v>>.>.v.v..>.v.v>..>v...>.v>>.>>
+v....>.v>..v.>..v...>...>>v>.....v.....>..vv>v...v..vvv>.v..vv>v>v..>.>....>....v..v>>......v.>.vv>..>v.>>..v.....>.v>>.v...v>..>.>.v.v.>>v
+..v>.v....>v.v.>..>v.>.v....>.>v..v>...>v.v.....>..vv...v>....v.v..v>v.>.v>>>v>..>v.>...>.>...v..>>>v>v>....v>>v..v..>>....v>>.vv>.vv.>.v..
+>v..>...>..>>.vv.>v.>.....v>v.vv>vvv.v>>.>..v.>>..v..>.....>>.>vv.v.>>>v.>vv...v.>v>..>..>..v.vv...v...v>>>vv>.v.v..>>>..>.>v>...vv>.v..v>.
+....>vv.>vv.v>.v....>>v..v>.v.>>v>vv>..v.>>.>v>v.v..vv.v.>.v..>.......>.>v>.v>vvv>v.>.>..>>v>..vv>.vvv>.>>..v>vv.>>..>v>v>.v.>>........>>v.
+>.>vvv.>>.>..vvv.v...vvv..>>v.>>.v>.v..>v.v>..v.>...>..vv>v........>v..v>.v...v.v..vv.v...v.v>..>v.....vv...v.vvvv.>.v...>>......>>.>>...>v
+...>>...>>>v..vv...v>.>.v....v>v...>.>>>v.>>.............vv.>..v>.>v.>v.>..>.vv..>>.v..>>>>....v..>>v...v.v.>.>v>>>..>......>vvv>vvv>>.>>vv
+...v...v.v>>.>.>>>..v.v.>..>>.>.>.v>....>v...>>.v>>vv.....>>.>...v......v...>v.vv>>vv>....>.>>vv>v.>>>.>>vv..>.v..v>v...v.v..v...v..>v...>>
+..v..v>vvvv..>>..v>>.>>....v>>v...>>>..v.....v....>.>v.>>v>v...vv.....>>.>v..v.>..>v...>>.>.>>...>>...>>.>>...v>..v...>v...>v>>>..v.v.vvv..
+...v..v>>>v..>>>v..v>.>vv>.v.>.v...>..>vv>.v>>v>..v>>......>.v>>...v>v..>v.>...>......v.vv..v.>v...vvv>.>..v..v..v>v..>..>........>>...v...
+.>.v>...vv..v.v>>>v..>v>..v..>>v....v..v>...>v..>.v.>....>v>v.>>v.>.v....v.>.v.>>v>>.v>>..v.v..>v.>..vv>.>>>>>v.>.v>v.>...v.vvv...v.>v..>>>
+.v>.>>..>v.v>>..>>...>v..v..>..v.>>>.>.vv...v....v...>vv>v>..v..vv>......v>v.>>>.v...v.>>.>.>v..>....vv.vvv..>v..vvv>>.v.v>....vvv>vv.v.v..
+>..>v.>.>..>v.v.vv.>>.>....v.>v..>v.>>.vv..>.>>.>.v.>>..vvv>>.v...v.>.v.v>...>>...>...vvv>>vvvv.>v.>v..v..v.v..v..v...>.>...>>v.....>v..>v.
+..>....>...>>.>....vv.v.v>.......>v...v..>..>>......>>.v...>.>.>...>>.v.v.v..v>.>>>v...>>>.v..>....v..>v.>.vv......v..v..>.>>.>..vv.>.v..>.
+v>..v.v>.>...vv.v.>>..v>.vv.>v.>.>..v>>vv>>.v.>.>>.vv.>.>..v....v>>v....>.>.v.>.>v>v.>.v>v.>..>....v...v.v>v.>.>v.....>>>>v.v.>..v......v>.
+..v...>v>.>...>.....vv.vv>>.>..>.v.v>...v....>..v.>v.....>......v>....vv.v.v.>...v..v.v..v.>v.v.>vvv..v....>..>..v.>v.v.vvv.v.>>>....>v....
+>>..vv...>>.vv>vv>.>>...>...>.>v>>..vv.>.>.v.v.>>...>..>>v>v>...>.v>....>.>.....v..>>vv..>.>...v>>v......v.>v......>>>..>>.>.>.v>>v...>v...
+>>>..vv>v....v>..>......v..>vv.>>v>..>.>..vv.vv.v.>>..v...>.v.v..>>.>..v..vv.v.>>..>>.......>.>>v.v>v..>v>v>>>...vv..>v>..vvvv.>v>v.v>.>>v.
+.>....v.>>.v.v..>vv.>v..>v...>.vv.v.>vv.v...v...>v..v..v..v...>...v.>>>.>>.....>.>....>v>vvv..>.vv.vv.v...>v.>.v.>.>...>v..vv>>>.>...vvv>.>
+v.....>...v.>....>v..>v.>.vv.v>>v..>....>vvv.>>.>v.v.v.v..v...>v.>v...v>v...v.v>v...v.>v..v.vv..v>v..>..v.>...>..>....>..v.vv>>.v...v>.vv.v
+....>>.>.vv>>..v>>vvv.......>v...>>.vv>..>.vv>v>.v>v..>v...vvv..>>v>.>.v.v..>...vv...v..>..vv..vv...>..v..>v>...>.v>.v....v..vvv.>v.>v>vv..
+>v..v.....vv>v>..>>..v...>v>..>...v>>>>....v..vvvv>.........>..v.v>.v...v.v....v.>v.v>.>v..v.vvv>.v>.>..>>..>>>..v.>>>v.>..>.>v..>vvv.>v>..

2021/src/common.rs

@@ -4,6 +4,9 @@ use std::io::Read;
 use std::marker::PhantomData;
 use std::str::FromStr;
 
+use nom::Finish;
+use nom::IResult;
+
 pub struct LineIter<'a> {
     reader: BufReader<&'a mut dyn Read>,
     buffer: String,
@@ -53,7 +56,7 @@ impl<'a, I: FromStr> LineParser<'a, I> {
     }
 }
 
-impl<'a, I: FromStr> Iterator for LineParser<'a, I> {
+impl<I: FromStr> Iterator for LineParser<'_, I> {
     type Item = I;
 
     fn next(&mut self) -> Option<Self::Item> {
@@ -61,6 +64,15 @@ impl<'a, I: FromStr> Iterator for LineParser<'a, I> {
     }
 }
 
+impl<'a, I: FromStr> From<LineIter<'a>> for LineParser<'a, I> {
+    fn from(iter: LineIter<'a>) -> Self {
+        Self {
+            iter,
+            _data: PhantomData,
+        }
+    }
+}
+
 /// Return two arguments in their natural PartialOrd order
 pub fn ordered<O: PartialOrd>(a: O, b: O) -> (O, O) {
     if a < b {
@@ -69,3 +81,74 @@ pub fn ordered<O: PartialOrd>(a: O, b: O) -> (O, O) {
         (b, a)
     }
 }
+
+pub fn read_input<I, P, O>(mut input: I, parser: P) -> O
+where
+    I: Read,
+    P: for<'a> FnOnce(&'a [u8]) -> IResult<&'a [u8], O>,
+{
+    let mut buffer = Vec::new();
+    input.read_to_end(&mut buffer).unwrap();
+
+    match parser(&buffer).finish() {
+        Ok((_, output)) => output,
+        Err(err) => {
+            panic!(
+                "Failed to parse input with error {:?} at \"{}\"",
+                err.code,
+                String::from_utf8_lossy(err.input)
+            );
+        }
+    }
+}
+
+#[derive(Default)]
+pub struct BitSet {
+    buffer: Vec<u32>,
+}
+
+impl BitSet {
+    pub fn new() -> Self {
+        Self::default()
+    }
+
+    pub fn with_capacity(capacity: usize) -> Self {
+        let buffer = vec![0; capacity / 32];
+
+        Self { buffer }
+    }
+
+    fn convert_value(value: usize) -> (usize, u32) {
+        let chunk = value / 32;
+        let bit = 1 << (31 - (value % 32));
+
+        (chunk, bit)
+    }
+
+    pub fn insert(&mut self, value: usize) -> bool {
+        let (chunk, bit) = Self::convert_value(value);
+
+        if self.buffer.len() <= chunk + 1 {
+            self.buffer.resize(chunk + 1, 0);
+        }
+
+        let not_present = self.buffer[chunk] & bit;
+
+        self.buffer[chunk] |= bit;
+
+        not_present == 0
+    }
+
+    pub fn len(&self) -> usize {
+        self.buffer.iter().map(|c| c.count_ones() as usize).sum()
+    }
+
+    pub fn contains(&self, value: usize) -> bool {
+        let (chunk, bit) = Self::convert_value(value);
+
+        self.buffer
+            .get(chunk)
+            .map(|&c| c & bit != 0)
+            .unwrap_or(false)
+    }
+}

2021/src/day02.rs

@@ -13,7 +13,7 @@ fn parse_input(input: &mut dyn Read) -> Vec<(Dir, i32)> {
     let mut moves = Vec::new();
 
     while let Some(line) = reader.next() {
-        let (dir, amount) = line.split_once(" ").unwrap();
+        let (dir, amount) = line.split_once(' ').unwrap();
 
         let dir = match dir {
             "up" => Dir::Up,

2021/src/day04.rs

@@ -1,94 +1,92 @@
-use std::collections::HashMap;
 use std::io::Read;
 
-use crate::common::LineIter;
+use nom::bytes::complete::tag;
+use nom::character::complete::multispace1;
+use nom::multi::many1;
+use nom::multi::separated_list1;
+use nom::sequence::preceded;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::read_input;
 
 #[derive(Debug)]
-struct BingoCard {
-    ticks: [[bool; 5]; 5],
-    mapping: HashMap<u8, (u8, u8)>,
-}
+struct BingoCard([(bool, u8); 25]);
 
 impl BingoCard {
-    pub fn cross(&mut self, num: u8) -> bool {
-        if let Some(&(x, y)) = self.mapping.get(&num) {
-            self.ticks[y as usize][x as usize] = true;
-            true
-        } else {
-            false
-        }
+    pub fn cross(&mut self, num: u8) -> Option<usize> {
+        self.0
+            .iter_mut()
+            .enumerate()
+            .find_map(|(pos, (ticked, x))| {
+                if *x == num {
+                    *ticked = true;
+                    Some(pos)
+                } else {
+                    None
+                }
+            })
     }
 
-    pub fn has_won(&self) -> bool {
+    pub fn has_won(&self, crossed: usize) -> bool {
         // Check horizontal lines
-        if self.ticks.iter().any(|s| s.iter().all(|&b| b)) {
+        if self
+            .0
+            .chunks_exact(5)
+            .nth(crossed / 5)
+            .unwrap()
+            .iter()
+            .all(|&b| b.0)
+        {
             return true;
         }
 
         // Check vertical lines
-        (0..5).any(|x| self.ticks.iter().all(|row| row[x]))
+        self.0.iter().skip(crossed % 5).step_by(5).all(|b| b.0)
 
         // Diagonals do not count
     }
 
     pub fn remaining(&self) -> u32 {
-        self.mapping
+        self.0
             .iter()
-            .filter_map(|(&num, &(x, y))| {
-                if self.ticks[y as usize][x as usize] {
-                    None
-                } else {
-                    Some(num as u32)
-                }
-            })
+            .filter_map(|&(ticked, num)| if !ticked { Some(num as u32) } else { None })
             .sum()
     }
 }
 
-fn read_input(input: &mut dyn Read) -> (Vec<u8>, Vec<BingoCard>) {
-    let mut reader = LineIter::new(input);
+fn parse_numbers(input: &[u8]) -> IResult<&[u8], Vec<u8>> {
+    use nom::character::complete::u8;
+    separated_list1(tag(","), u8)(input)
+}
 
-    let numbers: Vec<u8> = reader
-        .next()
-        .unwrap()
-        .split(',')
-        .map(|num| num.parse().unwrap())
-        .collect();
+fn parse_bingo(mut input: &[u8]) -> IResult<&[u8], BingoCard> {
+    use nom::character::complete::u8;
 
-    let mut bingo_cards = Vec::new();
+    let mut card = [0; 25];
 
-    while reader.next().is_some() {
-        let mut mapping = HashMap::with_capacity(25);
+    let mut parse_num = preceded(multispace1, u8);
 
-        for y in 0..5 {
-            reader
-                .next()
-                .unwrap()
-                .split(' ')
-                .filter_map(|s| if s.is_empty() { None } else { s.parse().ok() })
-                .enumerate()
-                .for_each(|(x, num)| {
-                    mapping.insert(num, (x as u8, y));
-                });
-        }
-
-        let card = BingoCard {
-            mapping,
-            ticks: Default::default(),
-        };
-
-        bingo_cards.push(card);
+    // fill doesn't work with preceded
+    for num in &mut card {
+        let result = parse_num(input)?;
+        *num = result.1;
+        input = result.0;
     }
 
-    (numbers, bingo_cards)
+    Ok((input, BingoCard(card.map(|x| (false, x)))))
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], (Vec<u8>, Vec<BingoCard>)> {
+    tuple((parse_numbers, many1(parse_bingo)))(input)
 }
 
 pub fn part1(input: &mut dyn Read) -> String {
-    let (numbers, mut bingo_cards) = read_input(input);
+    let (numbers, mut bingo_cards) = read_input(input, parse_input);
 
     for number in numbers {
         for card in &mut bingo_cards {
-            if card.cross(number) && card.has_won() {
+            if matches!(card.cross(number), Some(pos) if card.has_won(pos)) {
                 return (number as u32 * card.remaining()).to_string();
             }
         }
@@ -98,14 +96,18 @@ pub fn part1(input: &mut dyn Read) -> String {
 }
 
 pub fn part2(input: &mut dyn Read) -> String {
-    let (numbers, mut bingo_cards) = read_input(input);
+    let (numbers, mut bingo_cards) = read_input(input, parse_input);
     let mut bingo_won = vec![false; bingo_cards.len()];
     let mut num_won = 0;
     let to_win = bingo_cards.len();
 
     for num in numbers {
         for (won, card) in bingo_won.iter_mut().zip(bingo_cards.iter_mut()) {
-            if !*won && card.cross(num) && card.has_won() {
+            if *won {
+                continue;
+            }
+
+            if matches!(card.cross(num), Some(pos) if card.has_won(pos)) {
                 *won = true;
                 num_won += 1;
 

2021/src/day05.rs

@@ -1,69 +1,95 @@
-use std::collections::HashMap;
 use std::io::Read;
 use std::iter::repeat;
 
 use nom::bytes::complete::tag;
-use nom::sequence::tuple;
-use nom::Finish;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::separated_list1;
+use nom::sequence::separated_pair;
 use nom::IResult;
 
 use crate::common::ordered;
-use crate::common::LineIter;
+use crate::common::read_input;
+use crate::common::BitSet;
 
 type Coord = (u16, u16);
 
-fn coordinates(input: &str) -> IResult<&str, Coord> {
-    use nom::character::complete;
+fn coordinates(input: &[u8]) -> IResult<&[u8], Coord> {
+    use nom::character::complete::char;
+    use nom::character::complete::u16;
 
-    let (input, (x, _, y)) = tuple((complete::u16, complete::char(','), complete::u16))(input)?;
-
-    Ok((input, (x, y)))
+    separated_pair(u16, char(','), u16)(input)
 }
 
-fn line_definition(input: &str) -> IResult<&str, (Coord, Coord)> {
-    let (input, (begin, _, end)) = tuple((coordinates, tag(" -> "), coordinates))(input)?;
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<(Coord, Coord)>> {
+    let read_line = map(
+        separated_pair(coordinates, tag(" -> "), coordinates),
+        |(begin, end)| ordered(begin, end),
+    );
 
-    // Sorting the coordinates saves trouble later
-    Ok((input, ordered(begin, end)))
+    separated_list1(newline, read_line)(input)
 }
 
 fn stripe(
-    map: &mut HashMap<Coord, u16>,
+    once: &mut BitSet,
+    twice: &mut BitSet,
+    width: usize,
     xs: impl Iterator<Item = u16>,
     ys: impl Iterator<Item = u16>,
 ) {
     for (x, y) in xs.zip(ys) {
-        *map.entry((x, y)).or_default() += 1;
+        let index = x as usize + y as usize * width;
+        if !once.insert(index) {
+            twice.insert(index);
+        }
     }
 }
 
 fn part_common(input: &mut dyn Read, diagonals: bool) -> String {
-    let mut reader = LineIter::new(input);
-    let mut map = HashMap::new();
+    let lines = read_input(input, parse_input);
 
-    while let Some(line) = reader.next() {
-        let (begin, end) = line_definition(line).finish().unwrap().1;
+    let width = lines
+        .iter()
+        .map(|&(_, (x, _))| x as usize + 1)
+        .max()
+        .unwrap();
 
+    let mut once_map = BitSet::new();
+    let mut twice_map = BitSet::new();
+
+    for (begin, end) in lines {
         if begin.0 == end.0 {
             let y_range = begin.1..=end.1;
-            stripe(&mut map, repeat(begin.0), y_range);
+            stripe(
+                &mut once_map,
+                &mut twice_map,
+                width,
+                repeat(begin.0),
+                y_range,
+            );
         } else if begin.1 == end.1 {
             let x_range = begin.0..=end.0;
-            stripe(&mut map, x_range, repeat(begin.1));
+            stripe(
+                &mut once_map,
+                &mut twice_map,
+                width,
+                x_range,
+                repeat(begin.1),
+            );
         } else if diagonals {
             let x_range = begin.0..=end.0;
             let y_range = (begin.1.min(end.1))..=(begin.1.max(end.1));
 
             if begin.1 > end.1 {
                 // For a downward slope we need to reverse Y
-                stripe(&mut map, x_range, y_range.rev());
+                stripe(&mut once_map, &mut twice_map, width, x_range, y_range.rev());
             } else {
-                stripe(&mut map, x_range, y_range);
+                stripe(&mut once_map, &mut twice_map, width, x_range, y_range);
             }
         }
     }
 
-    map.values().filter(|&&v| v > 1).count().to_string()
+    twice_map.len().to_string()
 }
 
 pub fn part1(input: &mut dyn Read) -> String {
@@ -82,11 +108,6 @@ mod tests {
 
     const SAMPLE: &[u8] = include_bytes!("samples/05.txt");
 
-    #[test]
-    fn test_parser() {
-        assert_eq!(line_definition("6,4 -> 2,0"), Ok(("", ((2, 0), (6, 4)))));
-    }
-
     #[test]
     fn sample_part1() {
         test_implementation(part1, SAMPLE, 5)

2021/src/day11.rs

@@ -79,7 +79,7 @@ pub fn part2(input: &mut dyn Read) -> String {
     let mut grid = read_grid(input, &mut buffer);
     let mut todo = Vec::new();
 
-    let target = grid.iter().map(|line| line.len()).sum();
+    let target: usize = grid.iter().map(|line| line.len()).sum();
 
     (1..)
         .find(|_| advance(&mut grid, &mut todo) == target)

2021/src/day13.rs

@@ -1,9 +1,116 @@
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use itertools::Itertools;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::combinator::map;
+use nom::multi::many0;
+use nom::sequence::preceded;
+use nom::sequence::separated_pair;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::read_input;
+
+type Coords = (u16, u16);
+
+#[derive(Copy, Clone)]
+enum Fold {
+    X(u16),
+    Y(u16),
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+fn parse_input(input: &[u8]) -> IResult<&[u8], (Vec<Coords>, Vec<Fold>)> {
+    use nom::character::complete::char;
+
+    let parse_coordinates = many0(terminated(parse_coordinate, char('\n')));
+    let parse_folds = many0(terminated(parse_fold, char('\n')));
+
+    separated_pair(parse_coordinates, char('\n'), parse_folds)(input)
+}
+
+fn parse_coordinate(input: &[u8]) -> IResult<&[u8], Coords> {
+    use nom::character::complete::char;
+    use nom::character::complete::u16;
+
+    separated_pair(u16, char(','), u16)(input)
+}
+
+fn parse_fold(input: &[u8]) -> IResult<&[u8], Fold> {
+    use nom::character::complete::u16;
+
+    preceded(
+        tag("fold along "),
+        alt((
+            preceded(tag("x="), map(u16, Fold::X)),
+            preceded(tag("y="), map(u16, Fold::Y)),
+        )),
+    )(input)
+}
+
+fn apply_fold(dots: &mut [Coords], fold: Fold) {
+    match fold {
+        Fold::X(coord) => dots.iter_mut().for_each(|(x, _)| {
+            if *x >= coord {
+                *x = 2 * coord - *x;
+            }
+        }),
+        Fold::Y(coord) => dots.iter_mut().for_each(|(_, y)| {
+            if *y >= coord {
+                *y = 2 * coord - *y;
+            }
+        }),
+    }
+}
+
+fn print_dots(dots: &[Coords]) -> String {
+    let (width, height) = dots.iter().fold((0, 0), |(xc, yc), &(xn, yn)| {
+        (xc.max(xn as usize + 1), yc.max(yn as usize + 1))
+    });
+
+    let mut buffer = vec![b' '; (width + 1) * height - 1];
+
+    for &(x, y) in dots {
+        buffer[x as usize + (width + 1) * y as usize] = b'#';
+    }
+
+    for line in buffer.chunks_exact_mut(width + 1) {
+        line[width] = b'\n';
+    }
+
+    String::from_utf8(buffer).unwrap()
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let (mut dots, folds) = read_input(input, parse_input);
+
+    apply_fold(&mut dots, folds[0]);
+
+    dots.sort_unstable();
+
+    dots.into_iter().unique().count().to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let (mut dots, folds) = read_input(input, parse_input);
+
+    folds
+        .into_iter()
+        .for_each(|fold| apply_fold(&mut dots, fold));
+
+    print_dots(&dots)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/13.txt");
+
+    #[test]
+    fn sample_part() {
+        test_implementation(part1, SAMPLE, 17);
+    }
 }

2021/src/day14.rs

@@ -1,9 +1,123 @@
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use itertools::Itertools;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take_while;
+use nom::character::is_alphabetic;
+use nom::multi::many0;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::Finish;
+use nom::IResult;
+
+type Rule = (u8, u8, u8);
+
+type Pairs = [[u64; 26]; 26];
+type Rules = [[u8; 26]; 26];
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], (&[u8], Vec<Rule>)> {
+    use nom::character::complete::char;
+    use nom::number::complete::u8;
+
+    let parse_start = take_while(is_alphabetic);
+    let parse_rule = tuple((u8, u8, preceded(tag(" -> "), u8)));
+
+    tuple((
+        parse_start,
+        preceded(tag("\n\n"), many0(terminated(parse_rule, char('\n')))),
+    ))(input)
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+fn read_input(input: &mut dyn Read) -> (u8, u8, Pairs, Rules) {
+    let mut buffer = Vec::new();
+    input.read_to_end(&mut buffer).unwrap();
+
+    let (initial, rules) = parse_input(&buffer).finish().unwrap().1;
+
+    let mut pairs = Pairs::default();
+
+    for window in initial.windows(2) {
+        pairs[(window[0] - b'A') as usize][(window[1] - b'A') as usize] += 1;
+    }
+
+    let mut rule_map = Rules::default();
+    for (first, second, product) in rules {
+        rule_map[(first - b'A') as usize][(second - b'A') as usize] = product - b'A';
+    }
+
+    (
+        initial[0] - b'A',
+        initial[initial.len() - 1] - b'A',
+        pairs,
+        rule_map,
+    )
+}
+
+fn update(pairs: Pairs, rules: &Rules) -> Pairs {
+    let mut new_pairs = Pairs::default();
+
+    pairs.iter().enumerate().for_each(|(first, row)| {
+        row.iter().enumerate().for_each(|(second, &count)| {
+            let product = rules[first][second] as usize;
+            new_pairs[first][product] += count;
+            new_pairs[product][second] += count;
+        })
+    });
+
+    new_pairs
+}
+
+fn parts_common(input: &mut dyn Read, rounds: usize) -> String {
+    let (first, last, mut pairs, rules) = read_input(input);
+
+    (0..rounds).for_each(|_| pairs = update(pairs, &rules));
+
+    let mut pair_counts = [0; 26];
+    pairs.iter().enumerate().for_each(|(first, row)| {
+        row.iter().enumerate().for_each(|(second, &count)| {
+            pair_counts[first] += count;
+            pair_counts[second] += count;
+        })
+    });
+
+    pair_counts[first as usize] += 1;
+    pair_counts[last as usize] += 1;
+
+    // Now everything is counted twice, so first half everything
+    let counts = pair_counts.map(|pair_count| pair_count / 2);
+
+    match counts.into_iter().filter(|&c| c != 0).minmax() {
+        itertools::MinMaxResult::NoElements => unreachable!(),
+        itertools::MinMaxResult::OneElement(_) => 0,
+        itertools::MinMaxResult::MinMax(min, max) => max - min,
+    }
+    .to_string()
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    parts_common(input, 10)
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    parts_common(input, 40)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/14.txt");
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 1588);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 2188189693529u64);
+    }
 }

2021/src/day15.rs

@@ -1,9 +1,157 @@
+use std::cmp::Reverse;
+use std::collections::BinaryHeap;
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use crate::common::LineIter;
+
+type Point = (i32, i32);
+
+struct Map {
+    width: usize,
+    data: Vec<u8>,
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+impl Map {
+    pub fn from_input(input: &mut dyn Read) -> Self {
+        let mut reader = LineIter::new(input);
+
+        let mut data = reader.next().unwrap().as_bytes().to_owned();
+        let width = data.len();
+
+        while let Some(line) = reader.next() {
+            let line = line.as_bytes();
+            debug_assert_eq!(line.len(), width);
+
+            data.extend_from_slice(line);
+        }
+
+        data.iter_mut().for_each(|b| *b -= b'0');
+
+        Self { width, data }
+    }
+
+    pub fn from_input2(input: &mut dyn Read) -> Self {
+        let mut reader = LineIter::new(input);
+
+        let mut lines = Vec::new();
+
+        while let Some(line) = reader.next() {
+            let mut line = line.as_bytes().to_owned();
+            line.iter_mut().for_each(|b| *b -= b'0');
+            lines.push(line);
+        }
+
+        let mut data = Vec::new();
+        let width = lines[0].len();
+
+        for _y_repeat in 0..5 {
+            for line in &mut lines {
+                data.extend_from_slice(line);
+
+                for _ in 0..4 {
+                    let starting_pos = data.len() - width;
+                    data.extend_from_within(starting_pos..);
+                    let starting_pos = data.len() - width;
+                    data[starting_pos..]
+                        .iter_mut()
+                        .for_each(|b| *b = (*b % 9) + 1);
+                }
+
+                line.iter_mut().for_each(|b| *b = (*b % 9) + 1);
+            }
+        }
+
+        Self {
+            width: width * 5,
+            data,
+        }
+    }
+
+    pub fn shortest_path(&self, start: Point, end: Point) -> u32 {
+        let mut todo = BinaryHeap::new();
+        todo.push(Reverse((0, start)));
+
+        let mut best = vec![u32::MAX; self.data.len()];
+
+        let height = self.height() as i32;
+
+        while let Some(Reverse((distance, pos))) = todo.pop() {
+            if pos == end {
+                return distance;
+            }
+
+            if best[self.index(pos)] < distance {
+                continue;
+            }
+
+            let (x, y) = pos;
+
+            for dy in -1..=1 {
+                if y + dy < 0 || y + dy >= height {
+                    continue;
+                }
+
+                for dx in -1..=1 {
+                    if x + dx < 0 || (x + dx) >= self.width as i32 || dx * dy != 0 {
+                        continue;
+                    }
+
+                    let new = (x + dx, y + dy);
+                    let index = self.index(new);
+                    let new_distance = distance + self.data[index] as u32;
+
+                    if best[index] <= new_distance {
+                        continue;
+                    }
+
+                    best[index] = new_distance;
+
+                    todo.push(Reverse((new_distance, new)));
+                }
+            }
+        }
+
+        panic!("No route found from {:?} to {:?}", start, end);
+    }
+
+    pub fn height(&self) -> usize {
+        self.data.len() / self.width
+    }
+
+    pub fn index(&self, (x, y): Point) -> usize {
+        y as usize * self.width + x as usize
+    }
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let map = Map::from_input(input);
+
+    map.shortest_path((0, 0), (map.width as i32 - 1, map.height() as i32 - 1))
+        .to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let map = Map::from_input2(input);
+
+    map.shortest_path((0, 0), (map.width as i32 - 1, map.height() as i32 - 1))
+        .to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/15.txt");
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 40);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 315);
+    }
 }

2021/src/day16.rs

@@ -1,9 +1,220 @@
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use nom::bits::complete::tag;
+use nom::bits::complete::take;
+use nom::branch::alt;
+use nom::combinator::map;
+use nom::multi::count;
+use nom::sequence::preceded;
+use nom::sequence::tuple;
+use nom::IResult;
+
+type Input<'a> = (&'a [u8], usize);
+
+#[derive(Debug, Eq, PartialEq)]
+enum Contents {
+    Literal(u64),
+    Operator(u8, Vec<Packet>),
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+#[derive(Debug, Eq, PartialEq)]
+struct Packet {
+    version: u8,
+    contents: Contents,
+}
+
+fn capacity(input: Input) -> usize {
+    8 * input.0.len() - input.1 as usize
+}
+
+impl Packet {
+    pub fn version_sum(&self) -> u32 {
+        match &self.contents {
+            Contents::Literal(_) => self.version as u32,
+            Contents::Operator(_, sub_packets) => {
+                self.version as u32 + sub_packets.iter().map(Packet::version_sum).sum::<u32>()
+            }
+        }
+    }
+
+    pub fn value(&self) -> u64 {
+        match &self.contents {
+            Contents::Literal(val) => *val,
+            Contents::Operator(0, sub_packets) => sub_packets.iter().map(Packet::value).sum(),
+            Contents::Operator(1, sub_packets) => sub_packets.iter().map(Packet::value).product(),
+            Contents::Operator(2, sub_packets) => {
+                sub_packets.iter().map(Packet::value).min().unwrap()
+            }
+            Contents::Operator(3, sub_packets) => {
+                sub_packets.iter().map(Packet::value).max().unwrap()
+            }
+            Contents::Operator(5, sub_packets) => {
+                (sub_packets[0].value() > sub_packets[1].value()) as u64
+            }
+            Contents::Operator(6, sub_packets) => {
+                (sub_packets[0].value() < sub_packets[1].value()) as u64
+            }
+            Contents::Operator(7, sub_packets) => {
+                (sub_packets[0].value() == sub_packets[1].value()) as u64
+            }
+            unknown => panic!("unknown packet {:?}", unknown),
+        }
+    }
+}
+
+fn parse_literal(mut input: Input) -> IResult<Input, Contents> {
+    let mut val = 0;
+
+    loop {
+        let (new_input, result) = take::<_, u8, usize, _>(5)(input)?;
+        input = new_input;
+
+        val = (val << 4) | (result as u64 & 0xF);
+
+        if (result & 0x10) == 0 {
+            return Ok((input, Contents::Literal(val)));
+        }
+    }
+}
+
+fn parse_operator_len(input: Input) -> IResult<Input, Vec<Packet>> {
+    const SIZE_LEN: usize = 15;
+
+    let (mut input, to_read) = take(SIZE_LEN)(input)?;
+
+    let mut packets = Vec::new();
+
+    let initial = capacity(input);
+
+    while initial - capacity(input) < to_read {
+        let (new_input, packet) = parse_packet(input)?;
+        input = new_input;
+        packets.push(packet);
+    }
+
+    Ok((input, packets))
+}
+
+fn parse_operator_count(input: Input) -> IResult<Input, Vec<Packet>> {
+    const SIZE_LEN: usize = 11;
+
+    let (input, to_read) = take(SIZE_LEN)(input)?;
+
+    count(parse_packet, to_read)(input)
+}
+
+fn parse_packet(input: Input) -> IResult<Input, Packet> {
+    let parse_literal_packet = preceded(tag(4u8, 3usize), parse_literal);
+
+    let parse_operator_packet = map(
+        tuple((
+            take(3usize),
+            alt((
+                preceded(tag(0u8, 1usize), parse_operator_len),
+                preceded(tag(1u8, 1usize), parse_operator_count),
+            )),
+        )),
+        |(operator, contents)| Contents::Operator(operator, contents),
+    );
+
+    map(
+        tuple((
+            take(3usize),
+            alt((parse_literal_packet, parse_operator_packet)),
+        )),
+        |(version, contents)| Packet { version, contents },
+    )(input)
+}
+
+fn convert_hex(hex: &[u8]) -> Vec<u8> {
+    fn val(c: u8) -> u8 {
+        match c {
+            b'A'..=b'F' => c - b'A' + 10,
+            b'0'..=b'9' => c - b'0',
+            _ => panic!("Invalid hex digit {}", c),
+        }
+    }
+
+    let mut binary = Vec::with_capacity(hex.len() / 2);
+
+    binary.extend(
+        hex.chunks_exact(2)
+            .map(|chunk| (val(chunk[0]) << 4) | val(chunk[1])),
+    );
+
+    binary
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let mut buffer = Vec::new();
+    input.read_to_end(&mut buffer).unwrap();
+
+    let binary_data = convert_hex(&buffer);
+    let (_, packet) = parse_packet((&binary_data, 0)).unwrap();
+
+    packet.version_sum().to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let mut buffer = Vec::new();
+    input.read_to_end(&mut buffer).unwrap();
+
+    let binary_data = convert_hex(&buffer);
+    let (_, packet) = parse_packet((&binary_data, 0)).unwrap();
+
+    packet.value().to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use crate::test_implementation;
+
+    use super::*;
+
+    const SAMPLE: &[&[u8]] = &[
+        &*b"8A004A801A8002F478",
+        &*b"620080001611562C8802118E34",
+        &*b"C0015000016115A2E0802F182340",
+        &*b"A0016C880162017C3686B18A3D4780",
+    ];
+
+    #[test]
+    fn sample_part1() {
+        let answers = [16, 12, 23, 31];
+
+        for (&sample, answer) in SAMPLE.iter().zip(answers) {
+            test_implementation(part1, sample, answer);
+        }
+    }
+
+    #[test]
+    fn test_parse_literal() {
+        let (_, packet) = parse_packet((&convert_hex(b"D2FE28"), 0)).unwrap();
+
+        assert_eq!(
+            packet,
+            Packet {
+                version: 6,
+                contents: Contents::Literal(2021)
+            }
+        );
+    }
+
+    #[test]
+    fn test_parse_operator_len() {
+        let (_, packet) = parse_packet((&convert_hex(b"38006F45291200"), 0)).unwrap();
+
+        assert_eq!(packet.version, 1);
+
+        assert!(matches!(packet.contents, Contents::Operator(6, _)));
+    }
+
+    #[test]
+    fn test_parse_operator_count() {
+        let (_, packet) = parse_packet((&convert_hex(b"EE00D40C823060"), 0)).unwrap();
+
+        assert_eq!(packet.version, 7);
+
+        assert!(matches!(packet.contents, Contents::Operator(3, _)));
+    }
 }

2021/src/day17.rs

@@ -1,9 +1,150 @@
 use std::io::Read;
+use std::ops::RangeInclusive;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use nom::bytes::complete::tag;
+use nom::combinator::map;
+use nom::sequence::preceded;
+use nom::sequence::separated_pair;
+use nom::IResult;
+
+use crate::common::read_input;
+
+#[inline]
+fn solve_quadratic(a: f64, b: f64, c: f64) -> Option<f64> {
+    let d = b * b - 4. * a * c;
+
+    if d < 0. {
+        None
+    } else {
+        // Don't care about the smaller solution due to problem statement
+        if a > 0. {
+            Some((-b + d.sqrt()) / 2. / a)
+        } else {
+            Some((-b - d.sqrt()) / 2. / a)
+        }
+    }
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+fn position(initial: i32, time: i32) -> i32 {
+    time * (2 * initial - time + 1) / 2
+}
+
+fn find_hit(initial: i32, range: &RangeInclusive<i32>) -> impl Iterator<Item = i32> + '_ {
+    // y position at time x: f(x) = x * (1 + initial + initial - x) / 2
+    //                            = -1/2x^2 + (initial + 0.5)x
+    //
+    // to hit, find x := (max(box) + min(box)) / 2 = f(x)
+    //                                             = -1/2x^2 + (initial + 0.5)x
+    // -1/2x^2 + (initial + 0.5)x - (max(box) + min(box)) / 2 = 0
+    let middle = *range.start() as f64;
+    let b = initial as f64 + 0.5;
+    let hit = if let Some(hit) = solve_quadratic(-0.5, b, -middle) {
+        hit as i32
+    } else {
+        // Cause an empty range
+        -1
+    };
+
+    (0..=hit)
+        .rev()
+        .take_while(move |&n| range.contains(&position(initial, n)))
+}
+
+fn find_speed(x: i32, range: &RangeInclusive<i32>) -> Option<(i32, i32)> {
+    if *range.end() <= position(x, x) {
+        // Can and should come to a full stop
+        let max = solve_quadratic(0.5, 0.5, -*range.end() as f64)? as i32;
+
+        let min = (0..=max)
+            .rev()
+            .take_while(|&n| range.contains(&position(n, n)))
+            .last()?;
+
+        Some((min, max))
+    } else {
+        // Might hit the target at speed
+        let max = (x * x + 2 * *range.end() - x) / (2 * x);
+
+        let min = (0..=max)
+            .rev()
+            .take_while(|&n| range.contains(&position(n, n.min(x))))
+            .last()?;
+
+        Some((min, max))
+    }
+}
+
+fn parse_range(input: &[u8]) -> IResult<&[u8], RangeInclusive<i32>> {
+    use nom::character::complete::i32;
+
+    map(separated_pair(i32, tag(".."), i32), |(start, end)| {
+        start..=end
+    })(input)
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], (RangeInclusive<i32>, RangeInclusive<i32>)> {
+    preceded(
+        tag("target area: x="),
+        separated_pair(parse_range, tag(", y="), parse_range),
+    )(input)
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let (x_range, y_range) = read_input(input, parse_input);
+
+    let check_value =
+        |y_speed| find_hit(y_speed, &y_range).any(|time| find_speed(time, &x_range).is_some());
+
+    debug_assert!(*y_range.start() < 0);
+    let y_max = -*y_range.start();
+
+    (0..y_max)
+        .rev()
+        .find(|&speed| check_value(speed))
+        .map(|speed| position(speed, speed))
+        .unwrap()
+        .to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let (x_range, y_range) = read_input(input, parse_input);
+
+    let num_options = |y_speed| {
+        find_hit(y_speed, &y_range)
+            .filter_map(|time| find_speed(time, &x_range))
+            .reduce(|(a_min, a_max), (b_min, b_max)| (a_min.min(b_min), a_max.max(b_max)))
+            .map(|(min, max)| max - min + 1)
+            .unwrap_or(0)
+    };
+
+    debug_assert!(*y_range.start() < 0);
+    let y_max = -*y_range.start();
+
+    (-y_max..y_max).map(num_options).sum::<i32>().to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use crate::test_implementation;
+
+    use super::*;
+
+    const SAMPLE: &[u8] = &*b"target area: x=20..30, y=-10..-5";
+
+    #[test]
+    fn test_find_hit() {
+        assert_eq!(find_hit(2, &(-10..=-5)).collect::<Vec<_>>(), vec![7]);
+        assert_eq!(find_hit(3, &(-10..=-5)).collect::<Vec<_>>(), vec![9]);
+        assert_eq!(find_hit(0, &(-10..=-5)).collect::<Vec<_>>(), vec![5, 4]);
+    }
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 45);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 112);
+    }
 }

2021/src/day18.rs

@@ -1,9 +1,245 @@
+use std::fmt::Debug;
 use std::io::Read;
+use std::mem::replace;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use nom::branch::alt;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::many0;
+use nom::sequence::delimited;
+use nom::sequence::separated_pair;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::read_input;
+
+#[derive(Clone, Eq, PartialEq)]
+enum TurtleNumber {
+    Literal(u8),
+    Pair(Box<(TurtleNumber, TurtleNumber)>),
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+impl TurtleNumber {
+    pub fn add(self, other: Self) -> Self {
+        let mut new = TurtleNumber::Pair(Box::new((self, other)));
+        new.reduce();
+
+        new
+    }
+
+    pub fn magnitude(&self) -> u32 {
+        match self {
+            TurtleNumber::Literal(num) => *num as u32,
+            TurtleNumber::Pair(pair) => 3 * pair.0.magnitude() + 2 * pair.1.magnitude(),
+        }
+    }
+
+    fn reduce(&mut self) {
+        loop {
+            while self.try_explode(0).is_some() {}
+
+            if self.split() {
+                continue;
+            } else {
+                break;
+            }
+        }
+    }
+
+    fn leftmost_add(&mut self, value: u8) {
+        match self {
+            TurtleNumber::Literal(num) => *num += value,
+            TurtleNumber::Pair(pair) => pair.0.leftmost_add(value),
+        }
+    }
+
+    fn rightmost_add(&mut self, value: u8) {
+        match self {
+            TurtleNumber::Literal(num) => *num += value,
+            TurtleNumber::Pair(pair) => pair.1.rightmost_add(value),
+        }
+    }
+
+    fn try_explode(&mut self, depth: usize) -> Option<(Option<u8>, Option<u8>)> {
+        let pair = match self {
+            TurtleNumber::Literal(_) => return None,
+            TurtleNumber::Pair(pair) => pair,
+        };
+
+        if depth == 4 {
+            let original = replace(self, TurtleNumber::Literal(0));
+            let pair = match original {
+                TurtleNumber::Pair(pair) => *pair,
+                _ => unreachable!("Already checked for pair above"),
+            };
+
+            if let (TurtleNumber::Literal(first), TurtleNumber::Literal(second)) = pair {
+                Some((Some(first), Some(second)))
+            } else {
+                panic!("Too deeply nested turtle number: {:?}", pair);
+            }
+        } else {
+            match pair.0.try_explode(depth + 1) {
+                Some((left, Some(right))) => {
+                    pair.1.leftmost_add(right);
+                    Some((left, None))
+                }
+                Some((left, None)) => Some((left, None)),
+                None => match pair.1.try_explode(depth + 1) {
+                    Some((Some(left), right)) => {
+                        pair.0.rightmost_add(left);
+                        Some((None, right))
+                    }
+                    other => other,
+                },
+            }
+        }
+    }
+
+    pub fn split(&mut self) -> bool {
+        match self {
+            TurtleNumber::Literal(num) if *num >= 10 => {
+                let half = *num / 2;
+                let other = *num - half;
+                *self = TurtleNumber::from((half, other));
+                true
+            }
+            TurtleNumber::Pair(pair) => pair.0.split() || pair.1.split(),
+            _ => false,
+        }
+    }
+}
+
+impl Debug for TurtleNumber {
+    fn fmt(&self, f: &mut std::fmt::Formatter<'_>) -> std::fmt::Result {
+        match self {
+            Self::Literal(num) => write!(f, "{}", num),
+            Self::Pair(pair) => write!(f, "[{:?},{:?}]", pair.0, pair.1),
+        }
+    }
+}
+
+// Helper traits to easily convert tuples to turtle numbers
+impl From<u8> for TurtleNumber {
+    fn from(num: u8) -> Self {
+        TurtleNumber::Literal(num)
+    }
+}
+
+impl<T, U> From<(T, U)> for TurtleNumber
+where
+    T: Into<TurtleNumber>,
+    U: Into<TurtleNumber>,
+{
+    fn from((left, right): (T, U)) -> Self {
+        TurtleNumber::Pair(Box::new((left.into(), right.into())))
+    }
+}
+
+fn parse_turtle(input: &[u8]) -> IResult<&[u8], TurtleNumber> {
+    use nom::character::complete::char;
+    use nom::character::complete::u8;
+
+    alt((
+        map(u8, TurtleNumber::Literal),
+        map(
+            delimited(
+                char('['),
+                separated_pair(parse_turtle, char(','), parse_turtle),
+                char(']'),
+            ),
+            |pair| TurtleNumber::Pair(Box::new(pair)),
+        ),
+    ))(input)
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<TurtleNumber>> {
+    many0(terminated(parse_turtle, newline))(input)
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let turtles = read_input(input, parse_input);
+    turtles
+        .into_iter()
+        .reduce(|a, b| a.add(b))
+        .map(|num| num.magnitude())
+        .unwrap()
+        .to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let turtles = read_input(input, parse_input);
+
+    turtles
+        .iter()
+        .flat_map(|a| turtles.iter().map(|b| a.clone().add(b.clone()).magnitude()))
+        .max()
+        .unwrap()
+        .to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use crate::test_implementation;
+
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/18.txt");
+
+    #[test]
+    fn test_magnitude() {
+        let num: TurtleNumber = (
+            (((8, 7), (7, 7)), ((8, 6), (7, 7))),
+            (((0, 7), (6, 6)), (8, 7)),
+        )
+            .into();
+
+        assert_eq!(num.magnitude(), 3488);
+    }
+
+    #[test]
+    fn test_add() {
+        let input = TurtleNumber::from(((((4, 3), 4), 4), (7, ((8, 4), 9))));
+        let result = input.add((1, 1).into());
+
+        let expected = TurtleNumber::from(((((0, 7), 4), ((7, 8), (6, 0))), (8, 1)));
+        assert_eq!(result, expected);
+    }
+
+    #[test]
+    fn test_explode() {
+        let mut input1 = TurtleNumber::from((((((9, 8), 1), 2), 3), 4));
+        let output1 = TurtleNumber::from(((((0, 9), 2), 3), 4));
+
+        input1.reduce();
+        assert_eq!(input1, output1);
+
+        let mut input2 = TurtleNumber::from((7, (6, (5, (4, (3, 2))))));
+        let output2 = TurtleNumber::from((7, (6, (5, (7, 0)))));
+
+        input2.reduce();
+        assert_eq!(input2, output2);
+
+        let mut input3: TurtleNumber = TurtleNumber::from(((6, (5, (4, (3, 2)))), 1));
+        let output3 = TurtleNumber::from(((6, (5, (7, 0))), 3));
+
+        input3.reduce();
+        assert_eq!(input3, output3);
+
+        let mut input4 = TurtleNumber::from(((3, (2, (1, (7, 3)))), (6, (5, (4, (3, 2))))));
+        let output4 = TurtleNumber::from(((3, (2, (8, 0))), (9, (5, (7, 0)))));
+
+        input4.reduce();
+        assert_eq!(input4, output4);
+    }
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 4140);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 3993);
+    }
 }

2021/src/day19.rs

@@ -1,9 +1,355 @@
+use std::collections::HashMap;
+use std::collections::HashSet;
 use std::io::Read;
+use std::ops::Add;
+use std::ops::Deref;
+use std::ops::Sub;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use nom::bytes::complete::tag;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::many1;
+use nom::multi::separated_list1;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::read_input;
+
+#[derive(Debug, Copy, Clone, PartialEq, Eq, Hash, Default)]
+struct Point3(pub [i32; 3]);
+
+impl Point3 {
+    pub fn manhattan(&self) -> i32 {
+        self.0.into_iter().map(i32::abs).sum()
+    }
+
+    pub fn euler_square(&self) -> i32 {
+        self.0.into_iter().map(|c| c * c).sum()
+    }
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+impl Sub for Point3 {
+    type Output = Self;
+
+    fn sub(self, rhs: Self) -> Self::Output {
+        Point3([
+            self.0[0] - rhs.0[0],
+            self.0[1] - rhs.0[1],
+            self.0[2] - rhs.0[2],
+        ])
+    }
+}
+
+impl Add for Point3 {
+    type Output = Self;
+
+    fn add(self, rhs: Self) -> Self::Output {
+        Point3([
+            self.0[0] + rhs.0[0],
+            self.0[1] + rhs.0[1],
+            self.0[2] + rhs.0[2],
+        ])
+    }
+}
+
+struct Scanner {
+    visible: Vec<Point3>,
+    distances: HashMap<i32, (Point3, Point3)>,
+}
+
+impl Scanner {
+    pub fn new(visible: Vec<Point3>) -> Self {
+        let distances = visible
+            .iter()
+            .enumerate()
+            .flat_map(|(skip, &a)| {
+                visible[(skip + 1)..]
+                    .iter()
+                    .map(move |&b| ((a - b).euler_square(), (a, b)))
+            })
+            .collect();
+
+        Self { visible, distances }
+    }
+
+    pub fn can_overlap(&self, other: &Self) -> bool {
+        other
+            .distances
+            .keys()
+            .filter(|&k| self.distances.contains_key(k))
+            .count()
+            >= 11
+    }
+}
+
+impl Deref for Scanner {
+    type Target = [Point3];
+
+    fn deref(&self) -> &Self::Target {
+        &self.visible
+    }
+}
+
+struct Rotations<'a> {
+    points: &'a [Point3],
+    axes: [usize; 3],
+    rotation_index: usize,
+}
+
+impl<'a> Rotations<'a> {
+    const ROTATIONS: [[i32; 3]; 8] = [
+        [1, 1, 1],
+        [1, 1, -1],
+        [1, -1, 1],
+        [1, -1, -1],
+        [-1, 1, 1],
+        [-1, 1, -1],
+        [-1, -1, 1],
+        [-1, -1, -1],
+    ];
+
+    pub fn new(points: &'a [Point3]) -> Self {
+        Self {
+            points,
+            axes: [0, 1, 2],
+            rotation_index: 0,
+        }
+    }
+}
+
+impl Iterator for Rotations<'_> {
+    type Item = Vec<Point3>;
+
+    fn next(&mut self) -> Option<Self::Item> {
+        if self.rotation_index >= Self::ROTATIONS.len() {
+            if !next_permutation(&mut self.axes) {
+                return None;
+            }
+
+            self.rotation_index = 0;
+        }
+
+        let axes = &self.axes;
+        let rot = &Self::ROTATIONS[self.rotation_index];
+
+        let result = self
+            .points
+            .iter()
+            .map(|Point3(coords)| {
+                Point3([
+                    coords[axes[0]] * rot[0],
+                    coords[axes[1]] * rot[1],
+                    coords[axes[2]] * rot[2],
+                ])
+            })
+            .collect();
+
+        self.rotation_index += 1;
+
+        Some(result)
+    }
+}
+
+fn parse_point(input: &[u8]) -> IResult<&[u8], Point3> {
+    use nom::character::complete::char;
+    use nom::character::complete::i32;
+
+    map(
+        tuple((i32, preceded(char(','), i32), preceded(char(','), i32))),
+        |(x, y, z)| Point3([x, y, z]),
+    )(input)
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<Scanner>> {
+    use nom::character::complete::i32;
+    let parse_header = delimited(tag("--- scanner "), i32, tag(" ---\n"));
+
+    let parse_scanner = map(
+        preceded(parse_header, many1(terminated(parse_point, newline))),
+        Scanner::new,
+    );
+    separated_list1(newline, parse_scanner)(input)
+}
+
+fn find_pivot(group: &Scanner, related: &Scanner) -> Option<Point3> {
+    let mut counter = HashMap::new();
+
+    for (distance, &(a, b)) in &group.distances {
+        if related.distances.contains_key(distance) {
+            *counter.entry(a).or_insert(0) += 1;
+            *counter.entry(b).or_insert(0) += 1;
+        }
+    }
+
+    counter
+        .into_iter()
+        .max_by_key(|(_, count)| *count)
+        .map(|t| t.0)
+}
+
+fn try_overlap(matched: &Scanner, candidate: &Scanner) -> Option<(Point3, Scanner)> {
+    if !matched.can_overlap(candidate) {
+        return None;
+    }
+
+    let matched_pivot = find_pivot(matched, candidate)?;
+
+    let correct: HashSet<_> = matched.iter().map(|&base| base - matched_pivot).collect();
+
+    for rot in Rotations::new(candidate) {
+        for &start in &rot {
+            let translated_iter = rot.iter().map(|&other| other - start);
+
+            if translated_iter
+                .clone()
+                .filter(|p| correct.contains(p))
+                .count()
+                >= 12
+            {
+                // Found a solution, build the correct output
+                let translated = translated_iter.map(|point| point + matched_pivot).collect();
+
+                return Some((start - matched_pivot, Scanner::new(translated)));
+            }
+        }
+    }
+
+    None
+}
+
+fn parts_common(input: &mut dyn Read) -> (HashSet<Point3>, Vec<Point3>) {
+    let mut scanners = read_input(input, parse_input);
+
+    let mut points: HashSet<_> = scanners[0].iter().copied().collect();
+
+    let mut todo = vec![scanners.remove(0)];
+    let mut scanners_found = vec![Point3::default()];
+
+    while let Some(matched) = todo.pop() {
+        if scanners.is_empty() {
+            break;
+        }
+
+        let mut i = 0;
+
+        while i < scanners.len() {
+            if let Some((scanner, result)) = try_overlap(&matched, &scanners[i]) {
+                scanners.remove(i);
+                scanners_found.push(scanner);
+                points.extend(result.iter().copied());
+                todo.push(result);
+            } else {
+                i += 1;
+            }
+        }
+    }
+
+    assert!(scanners.is_empty());
+
+    (points, scanners_found)
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let (points, _) = parts_common(input);
+    points.len().to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let (_, scanners) = parts_common(input);
+
+    scanners
+        .iter()
+        .flat_map(|&first| {
+            scanners
+                .iter()
+                .map(move |&second| (first - second).manhattan())
+        })
+        .max()
+        .unwrap()
+        .to_string()
+}
+
+pub fn next_permutation<T: Ord>(list: &mut [T]) -> bool {
+    // Based on: https://en.cppreference.com/w/cpp/algorithm/next_permutation
+    if list.len() <= 1 {
+        return false;
+    }
+
+    if let Some((i, val1)) = list
+        .windows(2)
+        .enumerate()
+        .rev()
+        .find_map(|(i, window)| (window[0] < window[1]).then(|| (i, &window[0])))
+    {
+        let it2 = list
+            .iter()
+            .enumerate()
+            .skip(i + 1)
+            .rev()
+            .find_map(|(idx, val2)| (val1 < val2).then(|| idx))
+            .expect("Unreachable, ascending pair exists");
+
+        list.swap(i, it2);
+        list[(i + 1)..].reverse();
+        true
+    } else {
+        list.reverse();
+        false
+    }
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/19.txt");
+
+    #[test]
+    fn test_next_permutation() {
+        let mut list = [1, 2, 3];
+
+        assert!(next_permutation(&mut list));
+        assert_eq!(list, [1, 3, 2]);
+
+        assert!(next_permutation(&mut list));
+        assert_eq!(list, [2, 1, 3]);
+
+        assert!(next_permutation(&mut list));
+        assert_eq!(list, [2, 3, 1]);
+
+        assert!(next_permutation(&mut list));
+        assert_eq!(list, [3, 1, 2]);
+
+        assert!(next_permutation(&mut list));
+        assert_eq!(list, [3, 2, 1]);
+
+        // Note the negation!
+        assert!(!next_permutation(&mut list));
+        assert_eq!(list, [1, 2, 3]);
+
+        // 24 is a bit too much to write out, but we can check the number
+        let mut list2 = [1, 2, 3, 4];
+        for _ in 1..24 {
+            assert!(next_permutation(&mut list2));
+        }
+
+        // Should be back to the start
+        assert!(!next_permutation(&mut list2));
+        assert_eq!(list2, [1, 2, 3, 4]);
+    }
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 79);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 3621);
+    }
 }

2021/src/day20.rs

@@ -1,9 +1,176 @@
+use std::fmt::Display;
 use std::io::Read;
+use std::ops::Index;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use crate::common::BitSet;
+
+type Translation = [bool; 512];
+
+struct Field {
+    width: usize,
+    height: usize,
+    infinity: bool,
+    finite: BitSet,
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+impl Field {
+    pub fn from_input<'a>(input: impl Iterator<Item = &'a [u8]>) -> Self {
+        let mut input = input.peekable();
+
+        let width = input.peek().unwrap().len();
+
+        let mut finite = BitSet::new();
+
+        let len = input
+            .flatten()
+            .enumerate()
+            .map(|(index, &c)| {
+                if c == b'#' {
+                    finite.insert(index);
+                }
+            })
+            .count();
+
+        debug_assert_eq!(len % width, 0);
+        let height = len / width;
+
+        Self {
+            width,
+            height,
+            finite,
+            infinity: false,
+        }
+    }
+
+    pub fn advance(&mut self, translation: &[bool; 512]) {
+        const INDEX_MASK: usize = (1 << 9) - 1;
+
+        let new_width = self.width + 2;
+        let new_height = self.height + 2;
+
+        let mut new_finite = BitSet::with_capacity(new_width * new_height);
+
+        for y in 0..new_height {
+            let mut mask = if self.infinity { INDEX_MASK } else { 0 };
+
+            for x in 0..new_width {
+                const COLUMN_MASK: usize = 0b001001001;
+                let mut submask = if self.infinity { COLUMN_MASK } else { 0 };
+
+                for y in y.saturating_sub(2)..=y {
+                    submask = (submask << 3) | (self[(x, y)] as usize);
+                }
+
+                mask <<= 1;
+                mask &= !COLUMN_MASK;
+                mask |= submask;
+                mask &= INDEX_MASK;
+
+                if translation[mask] {
+                    let index = x + y * new_width;
+                    new_finite.insert(index);
+                }
+            }
+        }
+
+        self.width += 2;
+        self.height += 2;
+        self.finite = new_finite;
+        self.infinity = translation[if self.infinity { INDEX_MASK } else { 0 }];
+    }
+
+    pub fn len(&self) -> usize {
+        assert!(!self.infinity);
+        self.finite.len()
+    }
+}
+
+impl Index<(usize, usize)> for Field {
+    type Output = bool;
+
+    #[inline]
+    fn index(&self, (x, y): (usize, usize)) -> &Self::Output {
+        if x >= self.width || y >= self.height {
+            return &self.infinity;
+        }
+
+        let index = x + y * self.width;
+
+        if self.finite.contains(index) {
+            &true
+        } else {
+            &false
+        }
+    }
+}
+
+impl Display for Field {
+    fn fmt(&self, f: &mut std::fmt::Formatter<'_>) -> std::fmt::Result {
+        for y in 0..self.height {
+            for x in 0..self.width {
+                if self[(x, y)] {
+                    write!(f, "#")?
+                } else {
+                    write!(f, ".")?
+                }
+            }
+            writeln!(f)?;
+        }
+        Ok(())
+    }
+}
+
+fn read_input(input: &mut dyn Read) -> (Translation, Field) {
+    let mut buffer = Vec::new();
+    input.read_to_end(&mut buffer).unwrap();
+
+    let mut translation = [false; 512];
+
+    let mut it = buffer.split(|&b| b == b'\n');
+
+    translation
+        .iter_mut()
+        .zip(it.next().unwrap())
+        .for_each(|(t, &c)| *t = c == b'#');
+
+    let field = Field::from_input(it.skip(1));
+
+    (translation, field)
+}
+
+fn parts_common(input: &mut dyn Read, count: usize) -> String {
+    let (translation, mut field) = read_input(input);
+
+    for _ in 0..count {
+        field.advance(&translation);
+    }
+
+    field.len().to_string()
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    parts_common(input, 2)
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    parts_common(input, 50)
+}
+
+#[cfg(test)]
+mod tests {
+    use crate::test_implementation;
+
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/20.txt");
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 35);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 3351);
+    }
 }

2021/src/day21.rs

@@ -1,9 +1,171 @@
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use crate::common::LineIter;
+
+fn read_input(input: &mut dyn Read) -> (i32, i32) {
+    let mut reader = LineIter::new(input);
+
+    let mut helper = || {
+        reader
+            .next()
+            .unwrap()
+            .split(' ')
+            .last()
+            .unwrap()
+            .parse()
+            .unwrap()
+    };
+
+    let a = helper();
+    let b = helper();
+
+    (a, b)
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+#[inline]
+fn simulate(die: i32, pos: i32) -> i32 {
+    (pos + 3 * die + 3 - 1) % 10 + 1
+}
+
+fn find_repetition(mut pos: i32, mut die: i32) -> i32 {
+    let mut advance = 0;
+
+    for _ in 0..10 {
+        pos = simulate(die, pos);
+        advance += pos;
+        die = (die + 6) % 10;
+    }
+
+    advance
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    const TARGET_SCORE: i32 = 1000;
+
+    let (mut a, mut b) = read_input(input);
+
+    let a10 = find_repetition(a, 1);
+    let b10 = find_repetition(b, 4);
+
+    let a_win = TARGET_SCORE / a10;
+    let b_win = TARGET_SCORE / b10;
+
+    let win = a_win.min(b_win);
+    let mut a_score = win * a10;
+    let mut b_score = win * b10;
+    let mut die = 1;
+    let mut rolls = 3 * 20 * win;
+
+    let (loser_score, rolls) = if a_win < b_win {
+        while a_score < TARGET_SCORE {
+            a = simulate(die, a);
+            a_score += a;
+            rolls += 3;
+
+            if a_score < TARGET_SCORE {
+                b = simulate(die + 3, b);
+                b_score += b;
+                rolls += 3;
+            }
+
+            die = (die + 6) % 10;
+        }
+
+        (b_score, rolls)
+    } else {
+        while b_score < TARGET_SCORE {
+            a = simulate(die, a);
+            a_score += a;
+
+            b = simulate(die + 3, b);
+            b_score += b;
+
+            rolls += 6;
+
+            die = (die + 6) % 10;
+        }
+
+        (a_score, rolls)
+    };
+
+    (loser_score * rolls).to_string()
+}
+
+const MAX_TURNS: usize = 13;
+const ROLLS: [i32; 7] = [3, 4, 5, 6, 7, 8, 9];
+const FREQS: [u64; 7] = [1, 3, 6, 7, 6, 3, 1];
+
+fn multiverse(pos: i32) -> ([u64; MAX_TURNS], [u64; MAX_TURNS]) {
+    type State = [[u64; 10]; 21];
+
+    // Let's work with pos - 1 as pos for now, indexes nicer;
+    let pos = pos as usize - 1;
+
+    let mut alive = [0; MAX_TURNS];
+    let mut wins = [0; MAX_TURNS];
+
+    alive[0] = 1;
+
+    let mut current = [[0u64; 10]; 21];
+    current[0][pos] = 1;
+    let mut next = [[0u64; 10]; 21];
+
+    let mut helper = |turn, current: &State, next: &mut State| {
+        next.iter_mut().flatten().for_each(|v| *v = 0);
+
+        for (score, score_row) in current.iter().enumerate() {
+            for (pos, &pop) in score_row.iter().enumerate() {
+                for (roll, freq) in ROLLS.into_iter().zip(FREQS) {
+                    let new_pos = (pos + (roll as usize)) % 10;
+                    let new_score = score + new_pos + 1; // +1 because above
+                    let new_pop = freq * pop;
+
+                    if new_score >= next.len() {
+                        wins[turn] += new_pop;
+                    } else {
+                        alive[turn] += new_pop;
+                        next[new_score][new_pos] += new_pop;
+                    }
+                }
+            }
+        }
+    };
+
+    for turn in (1..MAX_TURNS).step_by(2) {
+        helper(turn, &current, &mut next);
+        helper(turn + 1, &next, &mut current);
+    }
+
+    (wins, alive)
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let (a, b) = read_input(input);
+
+    let (a_wins, a_alive) = multiverse(a);
+    let (b_wins, b_alive) = multiverse(b);
+
+    let a_winner: u64 = a_wins[1..].iter().zip(b_alive).map(|(&a, b)| a * b).sum();
+    let b_winner: u64 = b_wins.into_iter().zip(a_alive).map(|(a, b)| a * b).sum();
+
+    a_winner.max(b_winner).to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use crate::test_implementation;
+
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/21.txt");
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 739785);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 444356092776315u64);
+    }
 }

2021/src/day22.rs

@@ -1,9 +1,199 @@
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::separated_list1;
+use nom::sequence::preceded;
+use nom::sequence::separated_pair;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::read_input;
+
+type Point3 = [i32; 3];
+
+#[derive(Debug, Eq, PartialEq)]
+struct Cuboid {
+    lower: Point3,
+    upper: Point3,
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+impl Cuboid {
+    pub fn new(lower: Point3, upper: Point3) -> Self {
+        // The input uses an inclusive range for representation, but an exclusive one simplifies a
+        // lot of computations, so we convert here.
+        Self::new_internal(lower, upper.map(|c| c + 1))
+    }
+
+    fn new_internal(lower: Point3, upper: Point3) -> Self {
+        debug_assert!(lower.iter().zip(&upper).all(|(a, b)| a < b));
+        Self { lower, upper }
+    }
+
+    pub fn is_small(&self) -> bool {
+        self.lower
+            .iter()
+            .chain(&self.upper.map(|c| c - 1)) // begrudgingly convert back
+            .all(|c| c.abs() <= 50)
+    }
+
+    pub fn volume(&self) -> i64 {
+        self.lower
+            .iter()
+            .zip(&self.upper)
+            .map(|(&l, &h)| (h - l) as i64)
+            .product()
+    }
+
+    fn overlaps(&self, other: &Self) -> bool {
+        self.lower
+            .iter()
+            .zip(&self.upper)
+            .zip(other.lower.iter().zip(&other.upper))
+            .all(|((&al, &ah), (&bl, &bh))| al < bh && bl < ah)
+    }
+
+    pub fn retain_nonoverlapping(&self, other: &Self, new_cubes: &mut Vec<Self>) -> bool {
+        if !self.overlaps(other) {
+            // Cube can be kept as-is.
+            return true;
+        }
+
+        let mut lower = self.lower;
+        let mut upper = self.upper;
+
+        for axis in 0..3 {
+            if other.lower[axis] > self.lower[axis] {
+                let mut new_upper = upper;
+                new_upper[axis] = other.lower[axis];
+
+                new_cubes.push(Cuboid {
+                    lower,
+                    upper: new_upper,
+                });
+
+                lower[axis] = other.lower[axis];
+            }
+
+            if other.upper[axis] < self.upper[axis] {
+                let mut new_lower = lower;
+                new_lower[axis] = other.upper[axis];
+
+                new_cubes.push(Cuboid {
+                    lower: new_lower,
+                    upper,
+                });
+
+                upper[axis] = other.upper[axis];
+            }
+        }
+
+        false
+    }
+}
+
+fn parse_tuple(input: &[u8]) -> IResult<&[u8], (i32, i32)> {
+    use nom::character::complete::i32;
+    separated_pair(i32, tag(".."), i32)(input)
+}
+
+fn parse_cuboid(input: &[u8]) -> IResult<&[u8], Cuboid> {
+    map(
+        tuple((
+            parse_tuple,
+            preceded(tag(",y="), parse_tuple),
+            preceded(tag(",z="), parse_tuple),
+        )),
+        |((xl, xh), (yl, yh), (zl, zh))| Cuboid::new([xl, yl, zl], [xh, yh, zh]),
+    )(input)
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<(bool, Cuboid)>> {
+    let parse_state = alt((map(tag("on x="), |_| true), map(tag("off x="), |_| false)));
+    let parse_line = tuple((parse_state, parse_cuboid));
+
+    separated_list1(newline, parse_line)(input)
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let commands = read_input(input, parse_input);
+    let mut cubes = Vec::new();
+    let mut new_cubes = Vec::new();
+
+    for (state, cube) in commands.into_iter().filter(|(_, c)| c.is_small()) {
+        cubes.retain(|existing: &Cuboid| existing.retain_nonoverlapping(&cube, &mut new_cubes));
+
+        // Add new cubes to the end
+        cubes.append(&mut new_cubes);
+
+        if state {
+            cubes.push(cube);
+        }
+    }
+
+    cubes.iter().map(Cuboid::volume).sum::<i64>().to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let commands = read_input(input, parse_input);
+    let mut cubes = Vec::new();
+    let mut new_cubes = Vec::new();
+
+    for (state, cube) in commands {
+        cubes.retain(|existing: &Cuboid| existing.retain_nonoverlapping(&cube, &mut new_cubes));
+
+        // Add new cubes to the end
+        cubes.append(&mut new_cubes);
+
+        if state {
+            cubes.push(cube);
+        }
+    }
+
+    cubes.iter().map(Cuboid::volume).sum::<i64>().to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use crate::test_implementation;
+
+    use super::*;
+
+    const SAMPLE1: &[u8] = include_bytes!("samples/22.1.txt");
+    const SAMPLE2: &[u8] = include_bytes!("samples/22.2.txt");
+
+    #[test]
+    fn test_overlap() {
+        let cube_a = Cuboid {
+            lower: [1, 1, 1],
+            upper: [4, 4, 4],
+        };
+
+        let cube_b = Cuboid {
+            lower: [2, 2, 2],
+            upper: [3, 3, 3],
+        };
+
+        let mut new_cubes = Vec::new();
+
+        // B is fully inside A so it should overlap and the result should be empty
+        assert!(!cube_b.retain_nonoverlapping(&cube_a, &mut new_cubes));
+        assert_eq!(new_cubes, Vec::new());
+
+        // In the reverse case, we should have lots of new cubes
+        assert!(!cube_a.retain_nonoverlapping(&cube_b, &mut new_cubes));
+        assert_eq!(new_cubes.len(), 6);
+    }
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE1, 590784);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE2, 2758514936282235u64);
+    }
 }

2021/src/day23.rs

@@ -1,9 +1,451 @@
+use std::cmp::Reverse;
+use std::collections::hash_map::Entry;
+use std::collections::BinaryHeap;
+use std::collections::HashMap;
+use std::fmt::Display;
 use std::io::Read;
+use std::mem::swap;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use crate::common::LineIter;
+
+type Item<const S: usize> = (u32, State<S>);
+type Todo<const S: usize> = BinaryHeap<Reverse<Item<S>>>;
+type Visited<const S: usize> = HashMap<State<S>, u32>;
+
+#[derive(Debug, PartialEq, Eq, PartialOrd, Ord, Copy, Clone, Hash)]
+enum Pod {
+    A,
+    B,
+    C,
+    D,
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+impl Pod {
+    pub fn cost(self) -> u32 {
+        match self {
+            Pod::A => 1,
+            Pod::B => 10,
+            Pod::C => 100,
+            Pod::D => 1000,
+        }
+    }
+
+    pub fn dest(self) -> usize {
+        self as usize
+    }
+}
+
+impl TryFrom<usize> for Pod {
+    type Error = usize;
+
+    fn try_from(index: usize) -> Result<Self, Self::Error> {
+        match index {
+            0 => Ok(Pod::A),
+            1 => Ok(Pod::B),
+            2 => Ok(Pod::C),
+            3 => Ok(Pod::D),
+            _ => Err(index),
+        }
+    }
+}
+
+impl TryFrom<char> for Pod {
+    type Error = &'static str;
+
+    fn try_from(c: char) -> Result<Self, Self::Error> {
+        match c {
+            'A' => Ok(Pod::A),
+            'B' => Ok(Pod::B),
+            'C' => Ok(Pod::C),
+            'D' => Ok(Pod::D),
+            _ => Err("Invalid pod"),
+        }
+    }
+}
+
+#[derive(Debug, PartialEq, Eq, PartialOrd, Ord, Clone, Hash)]
+struct State<const S: usize> {
+    hallway: [Option<Pod>; 11],
+    rooms: [[Option<Pod>; S]; 4],
+}
+
+fn room_hallway_pos(room: usize) -> usize {
+    room * 2 + 2
+}
+
+fn abs_delta(a: usize, b: usize) -> usize {
+    if a < b {
+        b - a
+    } else {
+        a - b
+    }
+}
+
+impl<const S: usize> State<S> {
+    const VALID_HALLWAY_POS: [usize; 7] = [0, 1, 3, 5, 7, 9, 10];
+
+    pub fn is_done(&self) -> bool {
+        self == &State {
+            hallway: Default::default(),
+            rooms: [
+                [Some(Pod::A); S],
+                [Some(Pod::B); S],
+                [Some(Pod::C); S],
+                [Some(Pod::D); S],
+            ],
+        }
+    }
+
+    fn add_to_queue(self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        let entry = visited.entry(self.clone());
+
+        if matches!(&entry, Entry::Occupied(entry) if *entry.get() <= cost) {
+            // Already got a better one
+            return;
+        }
+
+        // nightly only :'(
+        // entry.insert(cost);
+        *entry.or_default() = cost;
+
+        todo.push(Reverse((cost + self.estimate(), self)))
+    }
+
+    fn estimate(&self) -> u32 {
+        // A* estimate. For every entry that is not already "at rest", the cost is the cost
+        // required to get it to the top of its intended room.
+
+        // Cost to enter the hole for all pods that still need to
+        let enter_estimate: u32 = self
+            .rooms
+            .iter()
+            .enumerate()
+            .map(|(index, room)| {
+                let pod = Pod::try_from(index).unwrap();
+
+                room.iter()
+                    .enumerate()
+                    .rev()
+                    .skip_while(|&(_, &entry)| entry == Some(pod))
+                    .map(|(index, _)| index as u32 + 1)
+                    .sum::<u32>()
+                    * pod.cost()
+            })
+            .sum();
+
+        // Cost for all of the hallway to move to above their intended rooms
+        let hallway_estimate: u32 = self
+            .hallway
+            .iter()
+            .enumerate()
+            .filter_map(|(pos, &pod)| {
+                let pod = pod?;
+
+                let destination_pos = room_hallway_pos(pod.dest());
+
+                Some(abs_delta(pos, destination_pos) as u32 * pod.cost())
+            })
+            .sum();
+
+        // Cost to move out of the room and above the correct rooms
+        let rooms_estimate: u32 = self
+            .rooms
+            .iter()
+            .enumerate()
+            .map(|(room_index, room)| {
+                let hallway_pos = room_hallway_pos(room_index);
+
+                room.iter()
+                    .enumerate()
+                    .rev()
+                    .skip_while(|&(_, &entry)| {
+                        entry.map(|pod| pod.dest() == room_index).unwrap_or(false)
+                    })
+                    .filter_map(|(room_pos, &pod)| {
+                        let pod = pod?;
+
+                        let destination_pos = room_hallway_pos(pod.dest());
+
+                        let steps = 1 + room_pos + abs_delta(hallway_pos, destination_pos).max(2);
+
+                        Some(steps as u32 * pod.cost())
+                    })
+                    .sum::<u32>()
+            })
+            .sum();
+
+        enter_estimate + hallway_estimate + rooms_estimate
+    }
+
+    pub fn generate_next(&self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        self.room_to_hallway(cost, todo, visited);
+        self.hallway_to_room(cost, todo, visited);
+    }
+
+    fn room_to_hallway(&self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        for (index, room) in self.rooms.iter().enumerate() {
+            // Check if we even want to move anything out of this room
+            if room
+                .iter()
+                .all(|entry| entry.map(|pod| pod.dest() == index).unwrap_or(true))
+            {
+                continue;
+            }
+
+            let (pos, pod) = room
+                .iter()
+                .enumerate()
+                .find_map(|(pos, entry)| entry.map(|pod| (pos, pod)))
+                .unwrap(); // Safe unwrap, we know it exists from above.
+
+            let base_cost = 1 + pos;
+            let hallway_pos = room_hallway_pos(index);
+
+            let mut queue_new = |new_pos, new_cost| {
+                let mut new_state = self.clone();
+                swap(
+                    &mut new_state.hallway[new_pos],
+                    &mut new_state.rooms[index][pos],
+                );
+
+                new_state.add_to_queue(new_cost + cost, todo, visited)
+            };
+
+            // Check positions to the left
+            for new_pos in (0..hallway_pos).rev() {
+                if self.hallway[new_pos].is_some() {
+                    // Hit an occupied room
+                    break;
+                }
+
+                if !Self::VALID_HALLWAY_POS.contains(&new_pos) {
+                    // Not allowed to stop here
+                    continue;
+                }
+
+                let new_cost = (base_cost + hallway_pos - new_pos) as u32 * pod.cost();
+                queue_new(new_pos, new_cost);
+            }
+
+            // And to the right
+            for new_pos in hallway_pos..self.hallway.len() {
+                if self.hallway[new_pos].is_some() {
+                    // Hit an occupied room
+                    break;
+                }
+
+                if !Self::VALID_HALLWAY_POS.contains(&new_pos) {
+                    // Not allowed to stop here
+                    continue;
+                }
+
+                let new_cost = (base_cost + new_pos - hallway_pos) as u32 * pod.cost();
+                queue_new(new_pos, new_cost);
+            }
+        }
+    }
+
+    fn hallway_to_room(&self, cost: u32, todo: &mut Todo<S>, visited: &mut Visited<S>) {
+        for (pos, pod) in self
+            .hallway
+            .iter()
+            .enumerate()
+            .filter_map(|(pos, pod)| pod.map(|pod| (pos, pod)))
+        {
+            let room = pod.dest();
+            let new_hallway_pos = room_hallway_pos(room);
+
+            // Check if the path is free
+            let in_between = if new_hallway_pos < pos {
+                &self.hallway[(new_hallway_pos + 1)..pos]
+            } else {
+                &self.hallway[(pos + 1)..new_hallway_pos]
+            };
+
+            if in_between.iter().any(Option::is_some) {
+                // Something's in the way
+                continue;
+            }
+
+            // Check if we can move into the room
+            if self.rooms[room]
+                .iter()
+                .copied()
+                .flatten()
+                .any(|other| other != pod)
+            {
+                // Scared of other pods
+                continue;
+            }
+
+            let room_pos = if let Some(pos) = self.rooms[room].iter().rposition(Option::is_none) {
+                pos
+            } else {
+                continue;
+            };
+
+            let new_cost = (abs_delta(pos, new_hallway_pos) + room_pos + 1) as u32 * pod.cost();
+            let mut new_state = self.clone();
+            swap(
+                &mut new_state.hallway[pos],
+                &mut new_state.rooms[room][room_pos],
+            );
+            new_state.add_to_queue(cost + new_cost, todo, visited);
+        }
+    }
+
+    pub fn solve(&self) -> u32 {
+        let mut todo = Todo::new();
+
+        let mut visited = HashMap::new();
+        visited.insert(self.clone(), 0);
+
+        todo.push(Reverse((self.estimate(), self.clone())));
+
+        while let Some(Reverse((_, state))) = todo.pop() {
+            let cost = *visited.get(&state).unwrap_or(&0);
+
+            if state.is_done() {
+                return cost;
+            }
+
+            state.generate_next(cost, &mut todo, &mut visited);
+        }
+
+        panic!("No route found!")
+    }
+}
+
+impl<const S: usize> Display for State<S> {
+    fn fmt(&self, f: &mut std::fmt::Formatter<'_>) -> std::fmt::Result {
+        let helper = |opt_pod| match opt_pod {
+            Some(Pod::A) => 'A',
+            Some(Pod::B) => 'B',
+            Some(Pod::C) => 'C',
+            Some(Pod::D) => 'D',
+            None => '.',
+        };
+        writeln!(f, "#############")?;
+        write!(f, "#")?;
+
+        for entry in self.hallway {
+            write!(f, "{}", helper(entry))?;
+        }
+        writeln!(f, "#")?;
+
+        for i in 0..S {
+            writeln!(
+                f,
+                "  #{}#{}#{}#{}#",
+                helper(self.rooms[0][i]),
+                helper(self.rooms[1][i]),
+                helper(self.rooms[2][i]),
+                helper(self.rooms[3][i])
+            )?;
+        }
+
+        write!(f, "  #########")
+    }
+}
+
+fn read_input(input: &mut dyn Read) -> State<2> {
+    let mut reader = LineIter::new(input);
+    let mut state = State {
+        hallway: Default::default(),
+        rooms: Default::default(),
+    };
+
+    let _ = reader.next();
+    let _ = reader.next();
+
+    let mut helper = |idx: usize| {
+        reader
+            .next()
+            .unwrap()
+            .chars()
+            .filter_map(|c| Pod::try_from(c).ok())
+            .zip(&mut state.rooms)
+            .for_each(|(pod, room)| room[idx] = Some(pod))
+    };
+
+    helper(0);
+    helper(1);
+
+    state
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let state = read_input(input);
+
+    state.solve().to_string()
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let state2 = read_input(input);
+
+    let state4 = State {
+        hallway: Default::default(),
+        rooms: [
+            [
+                state2.rooms[0][0],
+                Some(Pod::D),
+                Some(Pod::D),
+                state2.rooms[0][1],
+            ],
+            [
+                state2.rooms[1][0],
+                Some(Pod::C),
+                Some(Pod::B),
+                state2.rooms[1][1],
+            ],
+            [
+                state2.rooms[2][0],
+                Some(Pod::B),
+                Some(Pod::A),
+                state2.rooms[2][1],
+            ],
+            [
+                state2.rooms[3][0],
+                Some(Pod::A),
+                Some(Pod::C),
+                state2.rooms[3][1],
+            ],
+        ],
+    };
+
+    state4.solve().to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/23.txt");
+
+    #[test]
+    fn test_is_done() {
+        let state = State {
+            hallway: Default::default(),
+            rooms: [
+                [Some(Pod::A); 2],
+                [Some(Pod::B); 2],
+                [Some(Pod::C); 2],
+                [Some(Pod::D); 2],
+            ],
+        };
+
+        assert!(state.is_done());
+    }
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 12521);
+    }
+
+    #[test]
+    fn sample_part2() {
+        test_implementation(part2, SAMPLE, 44169);
+    }
 }

2021/src/day24.rs

@@ -1,9 +1,159 @@
+//! Very input-specific reverse-engineered solution
+//!
+//! # General implementation
+//!
+//! The code in the examples is a series of 14 times this:
+//!
+//! ```txt
+//! inp w       -> read digit
+//! mul x 0
+//! add x z
+//! mod x 26    -> x = z % 26
+//! div z $A    -> pop Z (see below)
+//! add x $B
+//! eql x w     -> x = ((z + $B) == w)
+//! eql x 0     -> x = ((z + $B) != w)
+//! mul y 0
+//! add y 25
+//! mul y x
+//! add y 1     -> if x { 26 } else { 1 }
+//! mul z y     -> if x { z *= 26 } (push z, see below)
+//! mul y 0
+//! add y w
+//! add y $C    -> y = w + $C
+//! mul y x
+//! add z y     -> if x { z += w + $C }
+//! ```
+//!
+//! `$A` is either `1` or `26` which we can translate to a bool `$A == 26` for convenience. This
+//! simplifies to the following rust.
+//!
+//! ```
+//! fn validate<const A: bool, const B: i32, const C: i32>(mut z: i32, digit: i32) -> i32 {
+//!     let x = (z % 26 + B) != digit;
+//!     if A {
+//!         z /= 26;
+//!     }
+//!
+//!     if x {
+//!         z = 26 * z + digit + C;
+//!     }
+//!
+//!     z
+//! }
+//! ```
+//!
+//! In human terms, `z` is used to hold a base 26 number. When `$A` is `true`, we pop off the least
+//! significant digit by dividing by 26. Then, depending on whether `(z + $B) % 26` is equal to our
+//! digit, we push `digit + $C`. Ideally, we should pop as often as we push in order to arrive at `z
+//! == 0` in the end. The input contains 7 pops, so we want each of those to not push.
+//!
+//! To solve this problem, we use a backtracking memoizing algorithm, where we cancel every sequence
+//! that fails to pop at some point. A pop is failed whenever we execute a validation pop where we
+//! can pop if `x` happened to be set to `0` at the time of the check. We can memoize this over the
+//! running value of `z`.
+//!
+//! This implementation probably doesn't work on other people's input; to fix it, you'll want to
+//! update the `parse_step` function. Good luck with that.
+use std::collections::HashMap;
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::separated_list1;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::read_input;
+
+type Cache = HashMap<(usize, i32), Option<i64>>;
+
+#[derive(Debug)]
+struct Step(bool, i32, i32);
+
+impl Step {
+    fn evaluate(&self, digit: i32, z: i32) -> Option<i32> {
+        if self.0 {
+            (z % 26 + self.1 == digit).then(|| z / 26)
+        } else {
+            Some(z * 26 + digit + self.2)
+        }
+    }
 }
 
-pub fn part2(_input: &mut dyn Read) -> String {
-    todo!()
+fn parse_step(input: &[u8]) -> IResult<&[u8], Step> {
+    use nom::character::complete::i32;
+
+    let parse_pop = preceded(
+        tag("inp w\nmul x 0\nadd x z\nmod x 26\ndiv z "),
+        alt((map(tag("1"), |_| false), map(tag("26"), |_| true))),
+    );
+
+    let parse_a = preceded(tag("\nadd x "), i32);
+
+    let parse_b = delimited(
+        tag("\neql x w\neql x 0\nmul y 0\nadd y 25\nmul y x\nadd y 1\nmul z y\nmul y 0\nadd y w\nadd y "),
+        i32,
+        tag("\nmul y x\nadd z y"),
+    );
+
+    map(tuple((parse_pop, parse_a, parse_b)), |(pop, a, b)| {
+        Step(pop, a, b)
+    })(input)
+}
+
+fn parse_input(input: &[u8]) -> IResult<&[u8], Vec<Step>> {
+    separated_list1(newline, parse_step)(input)
+}
+
+fn optimize(
+    current: usize,
+    steps: &[Step],
+    digits: &[i32],
+    z: i32,
+    cache: &mut Cache,
+) -> Option<i64> {
+    if current >= steps.len() {
+        return (z == 0).then(|| 0);
+    }
+
+    if let Some(&memoized) = cache.get(&(current, z)) {
+        return memoized;
+    }
+
+    let result = digits.iter().find_map(|&digit| {
+        let z = steps[current].evaluate(digit, z)?;
+        let result = optimize(current + 1, steps, digits, z, cache)?;
+
+        Some(result + digit as i64 * 10i64.pow(13 - current as u32))
+    });
+    cache.insert((current, z), result);
+
+    result
+}
+
+fn parts_common(input: &mut dyn Read, digits: &[i32]) -> String {
+    let steps = read_input(input, parse_input);
+
+    let mut cache = Cache::new();
+
+    optimize(0, &steps, digits, 0, &mut cache)
+        .unwrap()
+        .to_string()
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let digits = [9, 8, 7, 6, 5, 4, 3, 2, 1];
+
+    parts_common(input, &digits)
+}
+
+pub fn part2(input: &mut dyn Read) -> String {
+    let digits = [1, 2, 3, 4, 5, 6, 7, 8, 9];
+
+    parts_common(input, &digits)
 }

2021/src/day25.rs

@@ -1,5 +1,85 @@
 use std::io::Read;
 
-pub fn part1(_input: &mut dyn Read) -> String {
-    todo!()
+fn read_input(input: &mut dyn Read) -> (usize, Vec<u8>) {
+    let mut result = Vec::new();
+    input.read_to_end(&mut result).unwrap();
+
+    let width = result.iter().position(|&c| c == b'\n').unwrap();
+    result.retain(|c| !c.is_ascii_whitespace());
+
+    (width, result)
+}
+
+fn advance(width: usize, state: &mut [u8]) -> bool {
+    debug_assert_eq!(state.len() % width, 0);
+    let mut changes = false;
+
+    // Move the eastbound herd
+    for src in state.chunks_exact_mut(width) {
+        let swap_last = src[0] == b'.' && src[width - 1] == b'>';
+        let mut x = 0;
+
+        while x < src.len() - 1 {
+            if src[x] == b'>' && src[x + 1] == b'.' {
+                src.swap(x, x + 1);
+                changes = true;
+                x += 2;
+            } else {
+                x += 1;
+            }
+        }
+
+        if swap_last {
+            src.swap(0, width - 1);
+            changes = true;
+        }
+    }
+
+    // Then move the southbound herd. Need to do by column because of the first entry special case
+    for x in 0..width {
+        let last_index = state.len() - width + x;
+        let swap_last = state[x] == b'.' && state[last_index] == b'v';
+
+        let mut offset = x;
+
+        while offset < state.len() - width {
+            if state[offset] == b'v' && state[offset + width] == b'.' {
+                state.swap(offset, offset + width);
+                changes = true;
+                offset += 2 * width;
+            } else {
+                offset += width;
+            }
+        }
+
+        if swap_last {
+            state.swap(x, last_index);
+            changes = true;
+        }
+    }
+
+    changes
+}
+
+pub fn part1(input: &mut dyn Read) -> String {
+    let (width, mut state) = read_input(input);
+
+    (1..)
+        .find(|_| !advance(width, &mut state))
+        .unwrap()
+        .to_string()
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    use crate::test_implementation;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/25.txt");
+
+    #[test]
+    fn sample_part1() {
+        test_implementation(part1, SAMPLE, 58);
+    }
 }

2021/src/lib.rs

@@ -92,7 +92,7 @@ pub fn get_implementation(day: usize, part2: bool) -> Solution {
 
 #[cfg(test)]
 fn test_implementation(solution: Solution, data: &[u8], answer: impl ToString) {
-    let result = solution(&mut data.as_ref());
+    let result = solution(&mut &*data);
 
     assert_eq!(answer.to_string(), result);
 }

2021/src/samples/13.txt

@@ -0,0 +1,21 @@
+6,10
+0,14
+9,10
+0,3
+10,4
+4,11
+6,0
+6,12
+4,1
+0,13
+10,12
+3,4
+3,0
+8,4
+1,10
+2,14
+8,10
+9,0
+
+fold along y=7
+fold along x=5

2021/src/samples/14.txt

@@ -0,0 +1,18 @@
+NNCB
+
+CH -> B
+HH -> N
+CB -> H
+NH -> C
+HB -> C
+HC -> B
+HN -> C
+NN -> C
+BH -> H
+NC -> B
+NB -> B
+BN -> B
+BB -> N
+BC -> B
+CC -> N
+CN -> C

2021/src/samples/15.txt

@@ -0,0 +1,10 @@
+1163751742
+1381373672
+2136511328
+3694931569
+7463417111
+1319128137
+1359912421
+3125421639
+1293138521
+2311944581

2021/src/samples/17.txt

@@ -0,0 +1 @@
+target area: x=20..30, y=-10..-5

2021/src/samples/18.txt

@@ -0,0 +1,10 @@
+[[[0,[5,8]],[[1,7],[9,6]]],[[4,[1,2]],[[1,4],2]]]
+[[[5,[2,8]],4],[5,[[9,9],0]]]
+[6,[[[6,2],[5,6]],[[7,6],[4,7]]]]
+[[[6,[0,7]],[0,9]],[4,[9,[9,0]]]]
+[[[7,[6,4]],[3,[1,3]]],[[[5,5],1],9]]
+[[6,[[7,3],[3,2]]],[[[3,8],[5,7]],4]]
+[[[[5,4],[7,7]],8],[[8,3],8]]
+[[9,3],[[9,9],[6,[4,9]]]]
+[[2,[[7,7],7]],[[5,8],[[9,3],[0,2]]]]
+[[[[5,2],5],[8,[3,7]]],[[5,[7,5]],[4,4]]]

2021/src/samples/19.txt

@@ -0,0 +1,136 @@
+--- scanner 0 ---
+404,-588,-901
+528,-643,409
+-838,591,734
+390,-675,-793
+-537,-823,-458
+-485,-357,347
+-345,-311,381
+-661,-816,-575
+-876,649,763
+-618,-824,-621
+553,345,-567
+474,580,667
+-447,-329,318
+-584,868,-557
+544,-627,-890
+564,392,-477
+455,729,728
+-892,524,684
+-689,845,-530
+423,-701,434
+7,-33,-71
+630,319,-379
+443,580,662
+-789,900,-551
+459,-707,401
+
+--- scanner 1 ---
+686,422,578
+605,423,415
+515,917,-361
+-336,658,858
+95,138,22
+-476,619,847
+-340,-569,-846
+567,-361,727
+-460,603,-452
+669,-402,600
+729,430,532
+-500,-761,534
+-322,571,750
+-466,-666,-811
+-429,-592,574
+-355,545,-477
+703,-491,-529
+-328,-685,520
+413,935,-424
+-391,539,-444
+586,-435,557
+-364,-763,-893
+807,-499,-711
+755,-354,-619
+553,889,-390
+
+--- scanner 2 ---
+649,640,665
+682,-795,504
+-784,533,-524
+-644,584,-595
+-588,-843,648
+-30,6,44
+-674,560,763
+500,723,-460
+609,671,-379
+-555,-800,653
+-675,-892,-343
+697,-426,-610
+578,704,681
+493,664,-388
+-671,-858,530
+-667,343,800
+571,-461,-707
+-138,-166,112
+-889,563,-600
+646,-828,498
+640,759,510
+-630,509,768
+-681,-892,-333
+673,-379,-804
+-742,-814,-386
+577,-820,562
+
+--- scanner 3 ---
+-589,542,597
+605,-692,669
+-500,565,-823
+-660,373,557
+-458,-679,-417
+-488,449,543
+-626,468,-788
+338,-750,-386
+528,-832,-391
+562,-778,733
+-938,-730,414
+543,643,-506
+-524,371,-870
+407,773,750
+-104,29,83
+378,-903,-323
+-778,-728,485
+426,699,580
+-438,-605,-362
+-469,-447,-387
+509,732,623
+647,635,-688
+-868,-804,481
+614,-800,639
+595,780,-596
+
+--- scanner 4 ---
+727,592,562
+-293,-554,779
+441,611,-461
+-714,465,-776
+-743,427,-804
+-660,-479,-426
+832,-632,460
+927,-485,-438
+408,393,-506
+466,436,-512
+110,16,151
+-258,-428,682
+-393,719,612
+-211,-452,876
+808,-476,-593
+-575,615,604
+-485,667,467
+-680,325,-822
+-627,-443,-432
+872,-547,-609
+833,512,582
+807,604,487
+839,-516,451
+891,-625,532
+-652,-548,-490
+30,-46,-14

2021/src/samples/20.txt

@@ -0,0 +1,7 @@
+..#.#..#####.#.#.#.###.##.....###.##.#..###.####..#####..#....#..#..##..###..######.###...####..#..#####..##..#.#####...##.#.#..#.##..#.#......#.###.######.###.####...#.##.##..#..#..#####.....#.#....###..#.##......#.....#..#..#..##..#...##.######.####.####.#.#...#.......#..#.#.#...####.##.#......#..#...##.#.##..#...##.#.##..###.#......#.#.......#.#.#.####.###.##...#.....####.#..#..#.##.#....##..#.####....##...##..#...#......#.#.......#.......##..####..#...#.#.#...##..#.#..###..#####........#..####......#..#
+
+#..#.
+#....
+##..#
+..#..
+..###

2021/src/samples/21.txt

@@ -0,0 +1,2 @@
+Player 1 starting position: 4
+Player 2 starting position: 8

2021/src/samples/22.1.txt

@@ -0,0 +1,22 @@
+on x=-20..26,y=-36..17,z=-47..7
+on x=-20..33,y=-21..23,z=-26..28
+on x=-22..28,y=-29..23,z=-38..16
+on x=-46..7,y=-6..46,z=-50..-1
+on x=-49..1,y=-3..46,z=-24..28
+on x=2..47,y=-22..22,z=-23..27
+on x=-27..23,y=-28..26,z=-21..29
+on x=-39..5,y=-6..47,z=-3..44
+on x=-30..21,y=-8..43,z=-13..34
+on x=-22..26,y=-27..20,z=-29..19
+off x=-48..-32,y=26..41,z=-47..-37
+on x=-12..35,y=6..50,z=-50..-2
+off x=-48..-32,y=-32..-16,z=-15..-5
+on x=-18..26,y=-33..15,z=-7..46
+off x=-40..-22,y=-38..-28,z=23..41
+on x=-16..35,y=-41..10,z=-47..6
+off x=-32..-23,y=11..30,z=-14..3
+on x=-49..-5,y=-3..45,z=-29..18
+off x=18..30,y=-20..-8,z=-3..13
+on x=-41..9,y=-7..43,z=-33..15
+on x=-54112..-39298,y=-85059..-49293,z=-27449..7877
+on x=967..23432,y=45373..81175,z=27513..53682

2021/src/samples/22.2.txt

@@ -0,0 +1,60 @@
+on x=-5..47,y=-31..22,z=-19..33
+on x=-44..5,y=-27..21,z=-14..35
+on x=-49..-1,y=-11..42,z=-10..38
+on x=-20..34,y=-40..6,z=-44..1
+off x=26..39,y=40..50,z=-2..11
+on x=-41..5,y=-41..6,z=-36..8
+off x=-43..-33,y=-45..-28,z=7..25
+on x=-33..15,y=-32..19,z=-34..11
+off x=35..47,y=-46..-34,z=-11..5
+on x=-14..36,y=-6..44,z=-16..29
+on x=-57795..-6158,y=29564..72030,z=20435..90618
+on x=36731..105352,y=-21140..28532,z=16094..90401
+on x=30999..107136,y=-53464..15513,z=8553..71215
+on x=13528..83982,y=-99403..-27377,z=-24141..23996
+on x=-72682..-12347,y=18159..111354,z=7391..80950
+on x=-1060..80757,y=-65301..-20884,z=-103788..-16709
+on x=-83015..-9461,y=-72160..-8347,z=-81239..-26856
+on x=-52752..22273,y=-49450..9096,z=54442..119054
+on x=-29982..40483,y=-108474..-28371,z=-24328..38471
+on x=-4958..62750,y=40422..118853,z=-7672..65583
+on x=55694..108686,y=-43367..46958,z=-26781..48729
+on x=-98497..-18186,y=-63569..3412,z=1232..88485
+on x=-726..56291,y=-62629..13224,z=18033..85226
+on x=-110886..-34664,y=-81338..-8658,z=8914..63723
+on x=-55829..24974,y=-16897..54165,z=-121762..-28058
+on x=-65152..-11147,y=22489..91432,z=-58782..1780
+on x=-120100..-32970,y=-46592..27473,z=-11695..61039
+on x=-18631..37533,y=-124565..-50804,z=-35667..28308
+on x=-57817..18248,y=49321..117703,z=5745..55881
+on x=14781..98692,y=-1341..70827,z=15753..70151
+on x=-34419..55919,y=-19626..40991,z=39015..114138
+on x=-60785..11593,y=-56135..2999,z=-95368..-26915
+on x=-32178..58085,y=17647..101866,z=-91405..-8878
+on x=-53655..12091,y=50097..105568,z=-75335..-4862
+on x=-111166..-40997,y=-71714..2688,z=5609..50954
+on x=-16602..70118,y=-98693..-44401,z=5197..76897
+on x=16383..101554,y=4615..83635,z=-44907..18747
+off x=-95822..-15171,y=-19987..48940,z=10804..104439
+on x=-89813..-14614,y=16069..88491,z=-3297..45228
+on x=41075..99376,y=-20427..49978,z=-52012..13762
+on x=-21330..50085,y=-17944..62733,z=-112280..-30197
+on x=-16478..35915,y=36008..118594,z=-7885..47086
+off x=-98156..-27851,y=-49952..43171,z=-99005..-8456
+off x=2032..69770,y=-71013..4824,z=7471..94418
+on x=43670..120875,y=-42068..12382,z=-24787..38892
+off x=37514..111226,y=-45862..25743,z=-16714..54663
+off x=25699..97951,y=-30668..59918,z=-15349..69697
+off x=-44271..17935,y=-9516..60759,z=49131..112598
+on x=-61695..-5813,y=40978..94975,z=8655..80240
+off x=-101086..-9439,y=-7088..67543,z=33935..83858
+off x=18020..114017,y=-48931..32606,z=21474..89843
+off x=-77139..10506,y=-89994..-18797,z=-80..59318
+off x=8476..79288,y=-75520..11602,z=-96624..-24783
+on x=-47488..-1262,y=24338..100707,z=16292..72967
+off x=-84341..13987,y=2429..92914,z=-90671..-1318
+off x=-37810..49457,y=-71013..-7894,z=-105357..-13188
+off x=-27365..46395,y=31009..98017,z=15428..76570
+off x=-70369..-16548,y=22648..78696,z=-1892..86821
+on x=-53470..21291,y=-120233..-33476,z=-44150..38147
+off x=-93533..-4276,y=-16170..68771,z=-104985..-24507

2021/src/samples/23.txt

@@ -0,0 +1,5 @@
+#############
+#...........#
+###B#C#B#D###
+  #A#D#C#A#
+  #########

2021/src/samples/25.txt

@@ -0,0 +1,9 @@
+v...>>.vv>
+.vv>>.vv..
+>>.>v>...v
+>>v>>.>.v.
+v>v.vv.v..
+>.>>..v...
+.vv..>.>v.
+v.v..>>v.v
+....v..v.>

2022/Cargo.toml

@@ -0,0 +1,27 @@
+[package]
+name = "aoc_2022"
+version = "0.1.0"
+edition = "2021"
+
+# See more keys and their definitions at https://doc.rust-lang.org/cargo/reference/manifest.html
+
+[dependencies]
+anyhow = "1.0.66"
+clap = { version = "4.0.19", features = ["derive"] }
+itertools = "0.10.5"
+nom = "7.1.1"
+
+[dev-dependencies]
+criterion = "0.4.0"
+
+[profile.release]
+# Keep debug information in release for better flamegraphs
+debug = true
+
+[profile.bench]
+# And same for benchmarking
+debug = true
+
+[[bench]]
+name = "days"
+harness = false

2022/README.md

@@ -0,0 +1,20 @@
+# Advent of Code 2022
+
+Another year and another Advent of Code in Rust. Because last year went so well, this time we'll be
+aiming for a total time of under 250ms.
+
+```console
+$ target/release/aoc_2022 --help
+Advent of Code 2022 runner
+
+Usage: aoc_2022 [OPTIONS] <DAY>
+
+Arguments:
+  <DAY>  Which day to run
+
+Options:
+  -t, --time           Print time taken
+  -2, --part2          Run part 2 instead of part 1
+  -i, --input <INPUT>  Read input from the given file instead of stdin
+  -h, --help           Print help information
+```

2022/benches/days.rs

@@ -0,0 +1,46 @@
+use std::fs::File;
+use std::io::Read;
+
+use aoc_2022::get_implementation;
+use criterion::criterion_group;
+use criterion::criterion_main;
+use criterion::BenchmarkId;
+use criterion::Criterion;
+
+/// Number of days we have an implementation to benchmark
+const DAYS_IMPLEMENTED: u8 = 25;
+
+fn read_input(day: u8) -> Vec<u8> {
+    let input_path = format!("inputs/{:02}.txt", day);
+
+    let mut buffer = Vec::new();
+    File::open(input_path)
+        .expect("Failed to open input file")
+        .read_to_end(&mut buffer)
+        .expect("Failed to read input file");
+
+    buffer
+}
+
+pub fn benchmark_days(c: &mut Criterion) {
+    for day in 1..=DAYS_IMPLEMENTED {
+        let input = read_input(day);
+
+        let part1 = get_implementation(day, false).unwrap();
+
+        c.bench_with_input(BenchmarkId::new("part1", day), &input, |b, i| {
+            b.iter(|| part1(i));
+        });
+
+        if day < 25 {
+            let part2 = get_implementation(day, true).unwrap();
+
+            c.bench_with_input(BenchmarkId::new("part2", day), &input, |b, i| {
+                b.iter(|| part2(i));
+            });
+        }
+    }
+}
+
+criterion_group!(benches, benchmark_days);
+criterion_main!(benches);

2022/inputs/03.txt

@@ -0,0 +1,300 @@
+NJvhJcQWTJWTNTFFMTqqGqfTmB
+VwVzPldRZVLVRmfsvfjvqfmm
+ZDPDHZHVcvDhbvnv
+FHHwHBzzVCWWmmCzCPrVmgBwbLTtRFFbbbttRGRLjTcLpbbT
+vhZZvdsNSdSMdNvjncppCLcLnGnj
+CDZZsNZMZqdNSdlNZCqrzPHDzgrgzwVVWwmwwm
+ndlndntsFJntFvccLjjLrjBShcBBfc
+GpCGHzVwmmzqQWSSSfWHBhQL
+mpCMGGCZVzVwGGVwmJsZnFtZnTSTJtdsvl
+nCnPDGmDNmVCsVQDmGSWqvzchWSjjcWGqS
+gTnBRLpfTRnrTdZgdLfRdrThvqcvWWhFFWvcFSSgjqqzjv
+pfZfTMwrbLTTfsbmQtlVtHHnbs
+wNdSdsbTvTZMTvTv
+rrdRWdWQhFVdHWBGWQmmmnnMvCfmnhvmCmtZ
+rJrVDRWpGddpbSlNSlspPP
+chTNrthMMwWMTjfsmRzZszJpwm
+BLnFFCngbcBnbbldDlpRjGpmsCzGsGsRGmmG
+dqvnvlgbqtcPPMhH
+QcLNqZbCzJDQBJJRpwzRpdnRldgnpf
+GmmmvVGsHrWffrlwdCWd
+CMsFVVFjCmFStGQbbLZNBbJBcTjc
+LQVggbQvcLbQLHgvVLhWGGsChssrMWfzGccc
+qDnRTTRqJttPfWMChJhGslWlzh
+qRTRwPBTBtRZdnjnqqqnQVbjbNLFbbfLgVmgHLQm
+cZbzwCwZPlJcMLrNSNfHWNBBNZ
+vsQsDCqtsDhmtjVrBNWNjBHrhr
+TtDTGnvTlgbbRCGg
+BgBlplHlsgNNsJlVpBtPwJhMPRRQSSttRtSP
+bvhTnmdFTzddStwStQRddt
+ZnZDLvnvqZzbbhFzzmTbnFsVjVlNgsCCNVsVLpNWVgsB
+TdptqrrcVGhhzFtw
+DRnSfwJlDmmDDVGv
+RCSQNSCQZndwbcMqQrBB
+wvRlrlwVwwqzgbZRdCJBWfmdzCWfBdhf
+cFcsQpNtLLsGTtNGpMdPmDdPBmmBvJPWvDtC
+TpjssTFFvLLLcFFQpwbwwHngjHRrZRqZVH
+mqqddrPPcPmqPDlrQnjTrbvMvbHzzsjjpTvz
+gtBWgGgVhLGWHzMDztzstDHj
+hfWRhBBNBGgLNQDPwdNPcPdw
+LhQzdhhbTzpMhddhhhTzhnZcBFllHZFtrrHZHMHFjlHr
+mwwssqDvjptrvplr
+NCSgVDPDwmDgVJVpLfTznQJdhfLhnhQQ
+GzjzDhjhhZzcrRgQCBjBPBBjQCgT
+vHHHmntsbSgLwbsSmNHbwNbvpqPCBVppCpFTpTPTBtqWBCqV
+NJbwNSwdndvmvwhGhgzcfMcDJfgJ
+GncgDvvcMGnttjDvrgRRFSZZLZFWdJFJwGQwZBWZ
+bPqpChPfsshfZZBdZdLTFZ
+lNqqsClmbsNlPbHqPsmblmsrHdvdMngcVrjggvrvggRDcn
+bDvtgVVVpMQvjQWmQL
+rwTflmlfZJBBdQWQWjQqdM
+HsJJmZZwscHrwTrcRbzpcbPgtCSbgz
+CsCsRvshMjpbqCqf
+ncblgDBgtDmmmTlBgwlgbHHqMFHLqPDMHPHHpqWfFM
+TcBctSmTZTtSTzsZvsvJZRsGVb
+znznvngttwltzlLwhtThHbqHPvNbNHSSHmmNWHjP
+FBcLrRMFQpPqpPSpqHHW
+fRQMJZJfrcMcMVrQJJftnwCzVCltgTnstTVnVL
+MfLlRfCMrLzRlQgwNqQFcsGd
+jtTjjBTvbdqcGjqFcj
+vvShDSBDppzhCmzq
+plWMptTvfrnncvcRfwqzqLGhzhzThNzNNJqD
+jSdSHFPQQbdPCQCssjSbBmhJGNZZNGNqqJNBlJqqLh
+VCCCVCQgjdddjCgljCjbbwgRRttgrpftfWrgvpwpnf
+MWlbBcPjjvvjPWWMPqgRQZfJZDGGbRZJffQQwh
+HrHrnncHpzrJQJfVDQVR
+zzsSTtSTLzsspSdtTmHHmpmtFgqcgPlgFqWBqqqBMdWWvFlg
+nSqBbJbqlnBBClVZcMgZVgcP
+FQwrwHrRwWWFBRPNgNgcCGZZZC
+rWFWFTwpwwWzHrnDbfJDLDbBBbbz
+BMmNtLMMtFCNFNMvvLmcndpgcdgppPrgrGPPrgJD
+WVWWhbTtVnGpjrrPhr
+HWssSTHWfRHRsQQFLvfvFFCLCNMNlt
+sTmDsQffVrrLCjTFltTFWL
+BnwwQBJbJndMMRzMwCLlWlLWWCWLLtRlWF
+cqqBMcMqwnznMGzcvDmQhrvssHmPDVssrP
+pQGQGJDDrDVJbbfVzvvgPcCZwhZhncscZWWc
+SqMMlBBljMmRlchhPTqThCZnPs
+FMjMBmjRNFHQJJpHVhVDhG
+tHNNdBdNtBBBMgsMpsZm
+wVPzVvbwqzhrVqvjqzzsZpDsZDsZmsCPCgZgCM
+bVbvLThvvbrWqHmmnJLdHdJQLn
+PzTspPZpdLLDZTplPLpPDpvbfhnqNvqzfvNMzQQfNwnQ
+GWRHmjmFWMMSnhbhHw
+JWWcmtBrBtWBFWGJpsgTgldhLVLpJl
+DwLMDzLMhvMcwvgdVqWWlCVgvlqF
+TTSBBRpbStHZVgjWFldjRVlV
+SnbTBdJBmnpQzMPDMcMznr
+nNlMNBPPNtJQnbZhZsgSbh
+czzCjcwTdvSbgQNcgNQq
+VTdNdGDTzDTdlFFPtBrtLtDr
+FMbbfMlzvFsmgVZmmg
+SrNTHGmdSQDqLhtQhhgggs
+dRDTSDPPcHRdHGDHlwJBbmwljmMcfjbW
+sQgWLtqLtWhdqlpNZRpG
+blTHTjlvTCJnJvRZdGGhHHGZhFGV
+CCDlJclnCmbrmBMgcwcLWtcBsB
+vqPWWvqwwCFvFZfZPRFRrcGQrQwsDrNcrwnbDNcQ
+LVgJLSBBVtzTLzBMmTMJmLnnDNQcrsGbsQbNbrbDjs
+zggVSmmhVdfqFhvHWG
+WwdndGGmmmLwwwmRwWSncLRnZqZqhqZthBtqtBqZBgtdtvMH
+FfHHzlQQDsFzzrNsVTfttZvTvttTqqtbqb
+lQjFDNQFPjCsVCCDjGCwwSGGnccwcHppGp
+mrjggcFsFMjdjZRpSZpn
+NCqfLCFNbQPzPPlPzNfSRTRZdSdWWwndpqRSSd
+vDvzzbPQFNCFtllLLNMBhMcDHGBGMggMmcBc
+jhjlBvvnjbtDNPjtSjBDBbDNgHggrQrhghRQrqRrZcRwwqVg
+pLdTMsWdLLmpMdqZZdPdVqZgHPwH
+WLTCGmMLfPSlbGjlnnJD
+gtbwhgHbHgqqbgQthgQLtZZCRjMcjjnRnrRNJmMRJrNhRc
+bGWVTTvDvfpVFFBpvvVTdRDMJcrccCrJnMRnNnNCcc
+FVWTBsdvdTzTBFWssVQtLgSQtHqqPzPbqHbw
+dlzrPTSSjSrllzWhsvVmVtTRTWtf
+bJMpLGcqGhNbJQttVQmmvRWWsp
+qLbMwqqbGHFGzrlZrjhPHCrj
+rNrrffVlqqrfLlPpltcBBTTGRzzZRPRsBTcJ
+msbsmWSsMmQwjdMbWMhMhQmcRZRzGjTBGTBcBJBjCHJGcC
+FwWbvdhbmrsFrfrgsN
+rHjrQHdhdQrvSddcHWLssBSVVpBSWWWWWf
+JNfTGtqDwVWBMBMpwM
+qlltZgfJFvcRgcRjvc
+CqfcwfDqwwmRnnqmRdNRBTRTRrdGdNpTvF
+WVbzsZszBbrsvpdMpdQM
+tJhbVZHWLLHDgnSwnSSgHB
+TZCqqlTsqpZVVsZQJSBSLpLmppnJzmFz
+brSgNtGjjRjRRjDddDtrRJcJJbJmmwcmBmnPcJFwFB
+jgdRtMjNNjfqlMvShvSZSZ
+dJTdqCwMNCgqTQllGBdlGBmmmZ
+fcVfVcnbVfrwDLWVfncZBQPlBHRGljLZQjHGQl
+brwnnfSFDvfzCTqFzgMJTh
+njnsPBjjsrrnGLnbTTjGvcldQPCMllNzMvRQPCdd
+ggZgfZtmZVpqZqZWDgFmgqfCcQRcRcWhQcccQddMcvRQdQ
+tfqgggVgHpDwDtfwbGLJRjbLjsrLTj
+JmrfrmTlDWTfgQCdHCdpqBvQdD
+jsZtVzNsSNVQQHnBlVQR
+PljljFjPljSsLPtFLTTgTcFrrfMJmrrmrr
+hmGcmmndhmGnfmtGnDzFLwrFJQsQFzNFrNJG
+ZSqPlSWcWlbgqWVTVWRVZPrjQqjzjFNJzLsNJsLJNqNL
+RHcWTZbSMMMPgZcWgSWPPbVMDnBffmtdpDBddfnnvmCdfC
+vSJvsbFfJfvqCsTHJswssJnLTZjjhzrrzLrzLMrzhdjM
+pBNQDPcpmWDcBNgMMnZPVjdddnndhH
+QWlDgmpmgDBlGRgDDgffSqwSwGCwHfvqwSFJ
+jvlgvMJclPdGdtdcjMVmMHbFHFVHWHbZHZ
+CwhLzLhzQpnqfpfqDVHCHbsbDFZDmHmj
+LnBzfQjSzQrPvJvdSSrr
+wpcvcsqclDCnVCVvWfnZ
+BLRMRtbnbbBLNCjNCjVVZhbC
+rFgMPSRnrRpmqpJwqFDs
+LZQNQbMrZppLNLQplvlGLNvVmmmfjbwVCfjbwJwCmBCwfj
+ShTPRFtTHZPCsnwswsFwCF
+WtHRPdThSqZTRtDqtdRWTdpGDLLzrNczvzMGLlQLGDDM
+hdcffBvldjhCMljqPwWwWNwWdwqHZr
+LtQmbQRVsZQZMZPQSN
+tmMRsJMpDhjJzJhv
+wNQCMFCDQDBmrHmmRWrrHN
+SShLnfqpcqpSZSfrzJvRVrvfrrJH
+cRpqdGclpScltTQQtsFQMQsTCT
+NCjggZmgfBgnBmgWbcwcTFctcWWfvb
+HsDGthRGrtppSQpbFFJTVcJdFbTRvd
+rPDGhDDrSzZLtzBLZMCB
+RsBBMBsCBlFFCgRsBJzlMjMPNSdPhSrSrzLbmSDrDNmDSd
+pZHZZJpGHHHpTTHvTncZqVLdqLbhLrDLdhrSLLbLDDdD
+tGtwnJccvCtCffMBgt
+wbddvVjfwPhbjjbDbbvbjvTNCNmfHZfpCZRJNzCmJmnJNC
+BslcLtclZWsZJWNrRRNRpRmR
+BSLBlScGtFMcssMBBFGLlQZTDZQjPddVwwbTdvvdhTZb
+NSZHzmLZBnzHmLLzLSntDttDDtddhDtttDWW
+QgfjsrrvNNJwtMddcvcvtq
+jrfgfQpQrTTVLSNBClFV
+GQWcWWPPQRcrJQNDdRcDmmLCFSnqNSmqhCNvFnql
+zHfwjzpMjwZmCLqvvnlljC
+ZgtVZBtHHZtgQGgPrbPRJdPv
+TWdWpJTJTdgLWfWLlLFLrfrgBGsNqhGslBGHqSNqqBNshnws
+ZpQmjzbZZCjZCCCPZtttRCCwsBnHNssBHbShsshHqsGBqN
+RDRRPpPCzmZCtRpVVJFrfTfWFLLJggJrDv
+pDDFlglsvFMgntlTMMqNffmTdfddRM
+jhGJLVCHQpHGQCCzLjWdTTdZZdNdcRWNccWfNN
+jQjSGjrjCQLhzVSLSCSHGDpngbrnDFtFBwBglBnBvg
+wsLzstsgszcpcGLHGpcgcghlDBvQvjQvbFbQCbJBtCCJJv
+mnSqRSSqSRThWRnmWWRSJDFTFCFCblbBCFQFCjFj
+rZRRWqSSdZZfMVnZLspPsMgHpzMhHGPg
+mwHrCLSWWwrsHCHDDsVrsmhfFZFnSSBlFlgZbbgBglbggj
+GJdpcRtGJvNRdcPtdpJJdbQZfjfQBlnQBjnBtbfFnB
+qcPpqqzFzJqvPVCCmWrVwhrWrz
+jjMbvbhDvnRjNRGMmjbMZftSSwwwthJSffStctcwqd
+lTQrVlpCVvCcfdcSJqLVcw
+srHFWCHrFlrHlrsBsprljjRmDZZnmbDngNBgbNZv
+MgTlQJlTQJZWpgLrRssrVqqqpRts
+bBNbbzSSjMBPjzhMjsPtRVVRVPRqLttGGs
+SjHBbfjNCDfjZgTlZdMJnDJW
+lpThgTwtplhghgwhThqnnrdZctSZSjSZcRSRfbdrrc
+RBVBGvmBmfdrcvrbbr
+PmVGNGmmGRLLQwwLqTnglQ
+nHwnBwBTnFHQwRsMhwghmzcm
+GtprdCpdtqWdbqbrfdnPPszsWmRzRnShPszS
+dGptbCfCrlnVDBJNLDLLVDLQ
+CZtCjhTndCzqbCNq
+dwpGvpsmwGslDszrNNrzqDMzWMgJ
+vmcGccvpBVPTVTjTdTTTdZ
+jWZhvZLjZfCZDwrDrSSzJGhVdJccscGsgV
+blMBlRqqqgSJLBLcsJ
+blmHLmFMMMnRqLmMMFqHmfPDfjQDnCDDQrZvfCjvDr
+rnvnHrDLFZmMFLvrHQBMGQggBztzglplRl
+sbWWhdNzsshsfhcsjJJPPbWdtQGVGllRTRjRRgBgQlpRlppB
+PPCCwNWhPhNfWCzbqmFnDFFnCDLSrvZS
+GChNjwWlWJWTJZBggvdgnQgdhdnd
+HPsHfHHrpHDpFFrcSfsfpCMmQdntLBMgtmtBgDdLLC
+SqpPscpPzpSWzjlCjjCGjl
+nvgLvcLgvgvngbLprpJNTDCCRNVJrNPlDDTV
+WZsMtsffGQtMzWFqFmWmWsVNJNlDwwCDVRTwJlCCDVLz
+BQfGZGmmsMWFstWFmfMsfBccdncbpbSbvbbvHnLbpc
+tsmDsvswNZmcZTccfh
+zCTpGCbWBRWFWHGRFZJbMbJfnrhnhfMnnZ
+TzFGFBRLdpHHNNQddDQDvwQN
+fhBBpJgdHddjZQfmVmNzNNLmFN
+qvMRrvlbwqlbTTMBMvLssFNmVzzwFDmLLzVD
+TRSRWqRRMcBHhGHcdGgPGp
+lSjHmtmnpHStblnpSlHSrtmMzLWzqzqCZDDTzTTWqMFqCqVV
+sLRLLfPPRQfCTqqVVqFT
+dNJgRPNQNsJJhBRvdJvQvNNsjSrrSmrcctpbpHtBrBjLjmSH
+nwFwpppjfwSlpLTsqsTgNshhjM
+ccBRGvtsmgGNPqNNGP
+BCcJHvssdcWBCVmVHSSrZrwVzblpwbzZnf
+rcfQRrBPPczjcRBctZDNlnVNHbgZGjVDjN
+TvMsFJGSFMhJnNZlwVVnDNTZ
+qhSqqmqLCLhFdJLqSvLhmQRQRWcRPczPtzrCrWGRBp
+JVhdPhsFPFqLDBHVdHLPvhHDCMwcgJJwbwRgnnCMbwGwcmGC
+fzjzpTZTQQQLwCbgGgbMmQcR
+jzNpTzfSZtfNSWZlVVtdFFFDHHqLHVqv
+TwSNnSnSGVTpNppGlPTlTcVqQrRhVBqdqBRqZqQZqQ
+DcDCMfDbCMHJdrRBqbdjRBRZ
+gvftMCJHcHfCDmDLgfMmMmmWlwWnWsTTwlGTlWTwppNlGL
+pbGMbllDQPhhWWQDpPgVGlMCvRRrQLcCCcfBBQzLBcvQBv
+wqnJjSmjrstdqwwFBLcRsBRRszzLFC
+qwdddTJTdHtjndqJqHZHmwVWGpDbGTlbWWpWWrPGhhhM
+WGllqLjjLCpSffmBmvfpHs
+dnrQwZzRTdZwnCThdzzFTVmcBHBJBmsHfBPHcfvcSVHs
+QgQrzCdrTRCZzrZLbjGLqNMWGgNNLt
+sgPnhPPTTPTTwlJfwNHlqcfs
+LMCpFbLLbRpMGbMcCFLVlNlNqrHqVfbHHwNDwr
+GjBcCCtWMtMRZTSvgWQTngvg
+BCMtJJMpRDlMMvBJBBnfjtcjPhPmZgnhgdcf
+NrsrsqFNvrVLVGVrsHsqFgfmcPGdcmhfjdPgfjcnZd
+zFTzsNqHqFssLVLQqNTFbsBDwCCwvWlDwRMRCTRBDMDS
+zQtLgvggSRtgvVRtLvvnzdnjnGwGdmmrlpnlGz
+JssBFpqsDqPNnlWWjrrjqrnj
+DHDFBNDfPbJBsFHNMPvpvStQvMRVTtgVTVtv
+FvzttFvBTJJzLbvwhCnnVnWwjCnBNC
+mQdZgZPDPdPPSsMSQPdZgCwVGmnwnWpGnGhqNWjWCG
+ggdDgfQSdcjtFHjlLJfF
+ghcgScNNSsCvGSzmpVFlZbrzcFcV
+MWWRLRqqqdQwTtLjjmqMlFpFlzVnbFVDwplFzlDr
+LHMHqdHWjdQMdMtLHHLtWjJRsGCGSNghmSvPBJBNhsGfvfGP
+CbVqqqDbcbMHnnDqcCbrRFCfBvvwGjzrBwQGzrwwBjGwBQ
+sTPmpNWdWPTJssSSLPfNljjBvflGtjwwBzMG
+mmWgmgSZLTLMZWpnhqZbhFFCnhqnnn
+QQmjmZqnmQrfTZlbbcVbBcfbHfzf
+vpdSNShNppFdSRtdGBqvJBDlDzqbPPHVBH
+tRNSNRFhNpSRhFRMFtGhRGswLZZsZqWnmrmZwqwsTZmmmQ
+gGWCllFCGWtGGWdlGlWNZdwpnnSbwpMvpphZpndn
+RsshDDLcQVMSJQwJwnvw
+HVPzrPcDNhPFGhPC
+jtHQGHjGGtdTLjnqTQlmvRPRPBBwRBnFPPWP
+hZbzNzVrczZzcbNssVspZZVvBwbmPmJPWmvbBRvPlmvRJF
+fzNVDsZMhzpVhpVhlZcMNfcDDdQTLTjGDTCqGCjtSQHdHL
+GrbFggGrTrzSrgfwJjdTmwmNJZJd
+VMPQplPDptchwdsjmlml
+MqMWtBDPPWDWHQtvqQtWPjbzCGLgSBgGbzgrzFgnnz
+fcJccCcwcDfcpbRnCfWJnQJqtqtqPQdsGdgPsgTQqg
+LSjVMhzSFFrljdNbltNGtgdqQq
+MMhSHFFMLzBWDcHHcfcHwb
+rwmWtJWMwSNRJMtwNmMrrSsmtTjjlgqnTqZZZPlHnTngTTgn
+BGqGqqFBFggjjdGHlj
+QDhhLbDQCDFMNcmhRhqJNW
+BnRnRvMnLGLSCHvvSnlRfWbbTNQJsJsbNbJTBfQT
+tzMmmMwjhcpFjDmMcptrcjzFQggfQPTsWsfgNbbgfhJbPhQT
+FdzcrtDwDMtcwtFGRZdRLvdnHRSZZv
+HVpsSpvjpNjsBmbGFBnMNnDM
+WRRWhZtfrVtLJrBZMnDmDbnZBTGF
+thhPLzWzhzwPtLRLWrQlpPvvClcVcCppSvpl
+lZPbhnZLRPnnPZZPdlGMBWcBMgMQHBBcvvvzBL
+jpFjmwwwCDDbsjvjjgcvQgcNBQ
+rbFmppbwhqhGRGZr
+ggrLwFgWCBwbMWBbFwLMgNBZdmZHclJPllnJlNRPmSNZRR
+ppszzDfhDfhsqpnvDVTfGpSPlPmclHcdRcZmmmdPPGSP
+pvtDDVDVpqDfzDfngBLCwQrgCtCwFwrg
+pbGjFFGGDjpbsGsmNhNFNRBBBtRhhhHv
+JnczJVCvwWJvhPgghgNtNtNJ
+nwVSSzdzzqSpvQSZQG
+mssLLttQrsMrMzLCRmMmrrSQpvWpDNlBTBDlvNTccDQl
+HdHJwJqVPwHnqJwbjJbGjnSgSTWPpNgWWpgBBgcvDWWN
+ZHVwVZGwwdndqJVJqfHbGwnwrRLtLMftMvMMRrhmLMthhLmz
+RgHGLbTqlZlPRZPHfvvfZttJnvfvjnzr
+sVcChDVDccwNhhvjTvVzWJjnzFff
+mpNcCMTCGmLqBLGH
+wVJwHJHVMtMpBmDDWPQVPWDGDD
+zCrlZzCblBvnCDWNGLmvGDLPNG
+dqZglgbzrzbbgZqzTFSBHHFJSSSfjjSMfwhj
+NMWJSjLMCnHHNMNNHWCHMbVVGBPZTrPVPBVDrBSDGTTr
+zvttlFpgdtldwwvftPDPTWQdBZrsrWrGBZ
+hFlFmhRFvfCbmWJWHcnj

2022/inputs/05.txt

@@ -0,0 +1,514 @@
+        [G]         [D]     [Q]    
+[P]     [T]         [L] [M] [Z]    
+[Z] [Z] [C]         [Z] [G] [W]    
+[M] [B] [F]         [P] [C] [H] [N]
+[T] [S] [R]     [H] [W] [R] [L] [W]
+[R] [T] [Q] [Z] [R] [S] [Z] [F] [P]
+[C] [N] [H] [R] [N] [H] [D] [J] [Q]
+[N] [D] [M] [G] [Z] [F] [W] [S] [S]
+ 1   2   3   4   5   6   7   8   9 
+
+move 7 from 6 to 8
+move 5 from 2 to 6
+move 2 from 4 to 1
+move 1 from 4 to 5
+move 5 from 7 to 6
+move 7 from 6 to 3
+move 5 from 9 to 2
+move 6 from 2 to 3
+move 2 from 7 to 9
+move 20 from 3 to 1
+move 11 from 1 to 6
+move 1 from 9 to 8
+move 3 from 8 to 2
+move 8 from 1 to 5
+move 10 from 8 to 4
+move 7 from 6 to 4
+move 1 from 8 to 3
+move 8 from 1 to 7
+move 16 from 4 to 8
+move 1 from 9 to 8
+move 1 from 5 to 2
+move 4 from 7 to 4
+move 5 from 6 to 7
+move 1 from 6 to 1
+move 8 from 7 to 4
+move 1 from 6 to 9
+move 12 from 4 to 5
+move 3 from 2 to 5
+move 1 from 6 to 2
+move 1 from 3 to 7
+move 1 from 3 to 2
+move 1 from 9 to 3
+move 1 from 7 to 8
+move 1 from 7 to 5
+move 1 from 3 to 2
+move 4 from 5 to 7
+move 5 from 5 to 7
+move 1 from 4 to 3
+move 1 from 3 to 9
+move 3 from 1 to 8
+move 1 from 9 to 1
+move 2 from 2 to 1
+move 2 from 2 to 7
+move 8 from 8 to 1
+move 3 from 5 to 2
+move 8 from 7 to 5
+move 7 from 1 to 3
+move 3 from 1 to 7
+move 1 from 1 to 5
+move 1 from 3 to 7
+move 7 from 5 to 8
+move 2 from 2 to 8
+move 1 from 3 to 2
+move 1 from 2 to 4
+move 1 from 4 to 8
+move 13 from 8 to 1
+move 13 from 5 to 9
+move 2 from 5 to 2
+move 7 from 9 to 3
+move 12 from 8 to 3
+move 4 from 9 to 3
+move 1 from 3 to 4
+move 2 from 2 to 3
+move 1 from 1 to 6
+move 1 from 2 to 3
+move 1 from 5 to 9
+move 7 from 7 to 4
+move 10 from 1 to 8
+move 1 from 1 to 4
+move 1 from 9 to 5
+move 2 from 5 to 1
+move 1 from 6 to 5
+move 3 from 8 to 9
+move 5 from 4 to 3
+move 4 from 4 to 1
+move 7 from 1 to 6
+move 2 from 5 to 7
+move 35 from 3 to 4
+move 4 from 9 to 1
+move 19 from 4 to 8
+move 1 from 7 to 6
+move 1 from 9 to 2
+move 10 from 4 to 5
+move 2 from 4 to 7
+move 3 from 4 to 3
+move 1 from 2 to 8
+move 1 from 1 to 9
+move 3 from 3 to 6
+move 4 from 8 to 6
+move 4 from 5 to 2
+move 2 from 8 to 3
+move 3 from 5 to 9
+move 12 from 6 to 1
+move 8 from 8 to 6
+move 2 from 9 to 1
+move 1 from 4 to 1
+move 1 from 3 to 8
+move 3 from 7 to 8
+move 2 from 9 to 7
+move 1 from 6 to 7
+move 10 from 6 to 8
+move 4 from 2 to 5
+move 1 from 3 to 7
+move 7 from 5 to 7
+move 13 from 8 to 1
+move 29 from 1 to 4
+move 8 from 7 to 8
+move 1 from 1 to 3
+move 3 from 7 to 6
+move 1 from 1 to 9
+move 15 from 4 to 1
+move 1 from 3 to 6
+move 10 from 1 to 6
+move 10 from 6 to 7
+move 1 from 4 to 9
+move 1 from 9 to 1
+move 1 from 9 to 7
+move 6 from 7 to 8
+move 1 from 1 to 6
+move 5 from 6 to 5
+move 21 from 8 to 9
+move 5 from 1 to 9
+move 2 from 9 to 5
+move 3 from 5 to 6
+move 3 from 7 to 9
+move 4 from 4 to 6
+move 6 from 8 to 7
+move 6 from 6 to 3
+move 2 from 7 to 9
+move 1 from 7 to 2
+move 6 from 3 to 2
+move 1 from 6 to 4
+move 4 from 5 to 9
+move 1 from 4 to 5
+move 9 from 4 to 6
+move 7 from 6 to 4
+move 10 from 9 to 2
+move 5 from 7 to 5
+move 10 from 2 to 7
+move 2 from 5 to 4
+move 2 from 5 to 9
+move 4 from 9 to 4
+move 1 from 8 to 6
+move 7 from 7 to 2
+move 1 from 5 to 4
+move 2 from 7 to 1
+move 1 from 5 to 7
+move 3 from 6 to 2
+move 4 from 4 to 5
+move 1 from 2 to 7
+move 10 from 4 to 7
+move 3 from 7 to 3
+move 17 from 9 to 4
+move 1 from 1 to 4
+move 1 from 1 to 5
+move 5 from 2 to 7
+move 1 from 9 to 2
+move 5 from 4 to 8
+move 2 from 9 to 7
+move 4 from 8 to 1
+move 3 from 4 to 8
+move 1 from 2 to 5
+move 1 from 9 to 2
+move 6 from 4 to 8
+move 3 from 7 to 5
+move 1 from 4 to 9
+move 1 from 9 to 1
+move 3 from 1 to 9
+move 4 from 8 to 5
+move 2 from 9 to 8
+move 4 from 2 to 5
+move 8 from 7 to 2
+move 5 from 8 to 5
+move 2 from 7 to 8
+move 1 from 3 to 5
+move 1 from 1 to 2
+move 1 from 1 to 6
+move 2 from 3 to 6
+move 5 from 2 to 8
+move 4 from 7 to 1
+move 7 from 8 to 5
+move 1 from 1 to 5
+move 3 from 8 to 3
+move 1 from 9 to 3
+move 7 from 2 to 3
+move 2 from 2 to 8
+move 2 from 4 to 8
+move 1 from 8 to 5
+move 1 from 1 to 4
+move 2 from 4 to 7
+move 2 from 7 to 1
+move 3 from 2 to 3
+move 3 from 5 to 2
+move 1 from 8 to 3
+move 3 from 3 to 2
+move 5 from 2 to 1
+move 17 from 5 to 8
+move 9 from 8 to 1
+move 11 from 3 to 5
+move 8 from 8 to 5
+move 2 from 8 to 5
+move 16 from 1 to 4
+move 13 from 4 to 7
+move 6 from 5 to 2
+move 2 from 4 to 8
+move 5 from 7 to 9
+move 2 from 1 to 2
+move 7 from 7 to 1
+move 1 from 1 to 4
+move 1 from 9 to 8
+move 7 from 2 to 8
+move 1 from 4 to 7
+move 2 from 9 to 4
+move 1 from 4 to 1
+move 1 from 3 to 5
+move 2 from 9 to 8
+move 11 from 8 to 7
+move 2 from 6 to 5
+move 1 from 6 to 9
+move 1 from 1 to 9
+move 1 from 9 to 1
+move 4 from 1 to 4
+move 2 from 1 to 8
+move 1 from 1 to 2
+move 1 from 9 to 5
+move 2 from 4 to 3
+move 2 from 2 to 7
+move 2 from 3 to 9
+move 1 from 9 to 1
+move 1 from 9 to 1
+move 5 from 5 to 1
+move 19 from 5 to 6
+move 5 from 1 to 4
+move 1 from 2 to 9
+move 1 from 1 to 3
+move 7 from 5 to 8
+move 1 from 3 to 6
+move 8 from 7 to 3
+move 7 from 4 to 8
+move 3 from 8 to 5
+move 1 from 4 to 1
+move 1 from 9 to 4
+move 1 from 4 to 9
+move 1 from 5 to 2
+move 2 from 5 to 6
+move 2 from 8 to 2
+move 7 from 8 to 1
+move 1 from 1 to 7
+move 3 from 6 to 9
+move 2 from 3 to 2
+move 1 from 2 to 1
+move 1 from 8 to 7
+move 2 from 9 to 6
+move 2 from 9 to 5
+move 1 from 5 to 6
+move 1 from 2 to 8
+move 2 from 1 to 7
+move 1 from 4 to 3
+move 3 from 2 to 5
+move 7 from 1 to 3
+move 10 from 3 to 4
+move 3 from 5 to 4
+move 1 from 3 to 8
+move 3 from 3 to 2
+move 1 from 8 to 1
+move 1 from 1 to 3
+move 3 from 8 to 3
+move 5 from 4 to 6
+move 1 from 2 to 3
+move 4 from 6 to 4
+move 1 from 5 to 7
+move 4 from 3 to 4
+move 1 from 2 to 8
+move 12 from 7 to 6
+move 1 from 8 to 2
+move 2 from 2 to 7
+move 1 from 8 to 4
+move 23 from 6 to 3
+move 14 from 3 to 6
+move 15 from 4 to 6
+move 1 from 8 to 6
+move 10 from 3 to 7
+move 2 from 4 to 2
+move 11 from 7 to 8
+move 2 from 2 to 6
+move 44 from 6 to 9
+move 21 from 9 to 3
+move 12 from 3 to 6
+move 1 from 7 to 4
+move 1 from 4 to 7
+move 9 from 3 to 2
+move 2 from 8 to 6
+move 3 from 2 to 4
+move 17 from 9 to 1
+move 3 from 4 to 6
+move 2 from 2 to 9
+move 4 from 9 to 2
+move 10 from 6 to 9
+move 1 from 7 to 6
+move 4 from 9 to 5
+move 4 from 2 to 4
+move 14 from 1 to 5
+move 4 from 4 to 3
+move 3 from 2 to 9
+move 9 from 9 to 7
+move 1 from 2 to 5
+move 9 from 8 to 5
+move 8 from 7 to 2
+move 4 from 3 to 8
+move 5 from 6 to 2
+move 3 from 1 to 6
+move 1 from 7 to 1
+move 4 from 2 to 4
+move 3 from 6 to 4
+move 3 from 8 to 3
+move 13 from 5 to 2
+move 2 from 3 to 5
+move 12 from 5 to 9
+move 1 from 3 to 5
+move 1 from 5 to 9
+move 1 from 8 to 3
+move 4 from 9 to 5
+move 6 from 4 to 5
+move 12 from 9 to 7
+move 1 from 9 to 3
+move 1 from 3 to 2
+move 12 from 5 to 6
+move 12 from 7 to 2
+move 1 from 3 to 7
+move 1 from 4 to 8
+move 33 from 2 to 8
+move 1 from 7 to 5
+move 1 from 1 to 2
+move 4 from 5 to 4
+move 3 from 2 to 5
+move 34 from 8 to 6
+move 1 from 4 to 3
+move 1 from 5 to 7
+move 1 from 7 to 5
+move 3 from 4 to 9
+move 2 from 9 to 7
+move 1 from 9 to 4
+move 1 from 3 to 7
+move 1 from 5 to 8
+move 1 from 5 to 1
+move 1 from 5 to 7
+move 1 from 4 to 8
+move 1 from 1 to 4
+move 1 from 4 to 2
+move 3 from 7 to 5
+move 2 from 8 to 5
+move 1 from 2 to 8
+move 4 from 6 to 2
+move 1 from 8 to 6
+move 1 from 7 to 9
+move 29 from 6 to 7
+move 4 from 2 to 3
+move 2 from 5 to 8
+move 1 from 9 to 5
+move 2 from 8 to 1
+move 23 from 7 to 5
+move 2 from 6 to 1
+move 23 from 5 to 6
+move 1 from 3 to 6
+move 4 from 5 to 9
+move 2 from 1 to 3
+move 5 from 3 to 8
+move 2 from 6 to 5
+move 2 from 1 to 4
+move 1 from 9 to 8
+move 1 from 9 to 1
+move 1 from 4 to 6
+move 2 from 5 to 6
+move 6 from 7 to 8
+move 2 from 9 to 2
+move 18 from 6 to 5
+move 21 from 6 to 4
+move 1 from 1 to 6
+move 2 from 6 to 7
+move 2 from 7 to 9
+move 2 from 2 to 8
+move 7 from 4 to 3
+move 12 from 5 to 3
+move 1 from 9 to 5
+move 1 from 9 to 4
+move 6 from 5 to 2
+move 17 from 3 to 4
+move 3 from 4 to 3
+move 1 from 2 to 4
+move 5 from 2 to 8
+move 1 from 5 to 8
+move 19 from 8 to 7
+move 1 from 3 to 6
+move 1 from 8 to 4
+move 1 from 6 to 1
+move 15 from 4 to 6
+move 1 from 1 to 4
+move 3 from 3 to 5
+move 4 from 6 to 7
+move 1 from 4 to 7
+move 10 from 6 to 7
+move 16 from 4 to 5
+move 24 from 7 to 2
+move 8 from 7 to 8
+move 1 from 4 to 2
+move 6 from 8 to 7
+move 1 from 8 to 7
+move 1 from 6 to 9
+move 14 from 5 to 4
+move 9 from 7 to 8
+move 4 from 5 to 1
+move 2 from 1 to 5
+move 3 from 8 to 6
+move 2 from 6 to 9
+move 2 from 2 to 8
+move 6 from 2 to 7
+move 3 from 4 to 6
+move 1 from 3 to 4
+move 3 from 5 to 7
+move 1 from 6 to 9
+move 5 from 7 to 2
+move 4 from 9 to 1
+move 1 from 7 to 9
+move 9 from 8 to 4
+move 5 from 1 to 2
+move 2 from 6 to 1
+move 6 from 4 to 7
+move 1 from 7 to 3
+move 1 from 3 to 9
+move 1 from 9 to 7
+move 1 from 6 to 7
+move 9 from 4 to 5
+move 7 from 7 to 9
+move 3 from 7 to 5
+move 1 from 9 to 2
+move 6 from 9 to 8
+move 4 from 4 to 5
+move 1 from 4 to 2
+move 1 from 4 to 2
+move 2 from 1 to 2
+move 1 from 9 to 8
+move 10 from 2 to 4
+move 8 from 2 to 7
+move 12 from 2 to 9
+move 6 from 7 to 4
+move 1 from 1 to 2
+move 8 from 9 to 8
+move 7 from 5 to 1
+move 9 from 4 to 3
+move 14 from 8 to 4
+move 1 from 8 to 4
+move 1 from 1 to 5
+move 1 from 5 to 2
+move 3 from 2 to 4
+move 1 from 7 to 1
+move 1 from 7 to 3
+move 2 from 1 to 7
+move 3 from 5 to 7
+move 2 from 7 to 6
+move 1 from 6 to 5
+move 3 from 7 to 1
+move 1 from 6 to 8
+move 1 from 8 to 7
+move 1 from 3 to 6
+move 1 from 7 to 1
+move 4 from 1 to 4
+move 6 from 3 to 2
+move 3 from 1 to 2
+move 3 from 3 to 6
+move 3 from 2 to 6
+move 6 from 6 to 5
+move 1 from 1 to 4
+move 1 from 9 to 6
+move 5 from 2 to 1
+move 3 from 1 to 2
+move 2 from 9 to 8
+move 3 from 1 to 5
+move 1 from 9 to 7
+move 25 from 4 to 1
+move 1 from 1 to 7
+move 2 from 8 to 3
+move 13 from 1 to 9
+move 2 from 3 to 5
+move 8 from 5 to 9
+move 4 from 2 to 1
+move 2 from 6 to 7
+move 10 from 5 to 9
+move 4 from 7 to 2
+move 2 from 2 to 3
+move 9 from 9 to 2
+move 4 from 4 to 5
+move 4 from 5 to 4
+move 5 from 1 to 4
+move 10 from 4 to 5
+move 22 from 9 to 1
+move 2 from 2 to 7
+move 3 from 2 to 1
+move 6 from 2 to 6
+move 1 from 7 to 1
+move 10 from 5 to 7
+move 15 from 1 to 4
+move 13 from 1 to 5
+move 3 from 6 to 8
+move 1 from 8 to 9

2022/inputs/06.txt

@@ -0,0 +1 @@
+grvrnvrnnjljbjqjpqjjvhhzwwrbwwbblrltrrpbbbbqnnqbbbbsvbvmbvmbbrsrqrzrllwbbbqzqrqnqrnrjnnjccdggwqqhrrjcjmjmllgrlglhlclmlvlvsshwwsggmfmdfddgdfftrrczrcczhzppgdgrdggghmmdwwqgggslglfgfcgccmjcjwjrwjrjcrjjsgjjvddpwpgpbbgwbgwwhnhfftbffhpfphhfqfrqfrfnfpprvrsrhrfrllfhhrsrhssvfsvsnvsnsswtwtlthllrjjwddtggzczgcchwcwppfbbdvdrdzrdrvrwwsbsfbssqfsfjsjcscttlztllgjjlbbdsdtssvvvwlvlqqnhqqtdqtddjcdcjjpbphhgtgtqtzqqzhqqtgtvtmvtvrvqrvvfmfmppzzbwwnddzttfpfrrlddbppfqppnwnswwdhwdwjjqljqqthtnhnddgmgcmgcmgcmmfmfttrzzfdzztllmjlllgcgbbcqcvccpnndbdjbjmmzbztzptzpprpddptpprhhvlvmlmpmmljjnnjsjfjjvgjjvzzfgfzfbftbftttgstgstgtpggflfcfqqtctltgltldlzdlzzmmlddnvddzfddppmnpptzptpvttwstwswvwrvvbfbjjjbmjjdvdvrvdddrwrhrzrqqhghhrwhwhrrmppsgpsgszzdfdfwwmtwtvwvgvffmqqqtqntqnnjcncbnbwnnzggrdrqqjbqjjwjqqqwlqwlwzlljhhfsfsqsrqqhwqqwbbqbvvlflrrlglbbjhhjmhjjcmcjcgczcfcgcqqczcnnvjnnlddmpmcppgvgjgddvrrnsnmnqmqgmmnppwgwcgwgssbddgtdgdgmdgmgvvmjmvmjmvvsfssdgdghdggbfbqbdbjbsbmmrpmrprggbllwrwpwtppzvppzsssdnsdnnvnhvvvzvfzfqqnnmlnltldtdvdbdblddsmmlccmlmvlmvmmcsctctrtsrstsbsrshsddlmddmppgsscttnrtrqqcvcwwlnlznnnvcnvvtnvnbnmbmvmppjgjdjtddmpdmdvvmgvvdqdlqlhhzccsggjdjsdsttctjctjtfjttppdzpzzbjbwwmwbblslzslzszlzrrcbrrfggvcczjjtbbdnnggbwblwlbwlwqqfvfqfddrrfccvlllhmhhhrthrthrrnbnzbbpzplphprrrnbbghhnshnhbblqqqvwwffnmnmhhtccpqpvqvbvnvvfnfsnffdjdllwffcddgcgrgjrggchcpcddtbbdtdmtdmmhhtphtpppclcpcvcjvcjjfqfzqqphpnhnrnhhpdhhtfhhbbmqmfmsmvssgqqfssqgglnnqmnmbnmbbllrdrgdrdvrdvdsvvnddgtgddcdqdsqdqbqqlhhwdhdgdcgcdchchrchhpvvpgvgrrfggwfwgmpddbhfngtrwswfszgsggnpsntjpslrpjqsffzrlnbnzdtqpqtjzwlhhgrsrbvnccnsjmzcbqgcbtbqlzhnpnhhrrvqwjwzzvrlcrmjhcscrqhpqmfzbnvcwwqhcjjlnggmpbwztzfswmsbjshnsgfmdlzvzczhrdwgwbghszpnbfpctrshbfhspsczcqcrrqcpwwpfzhjqtpqgjbztrpzrlgfdjbmlwdvlvnfmdzbwsbbhlbszvwcpztlchjrqbmsftltmqpfgdpmdgjvwqqtjsqlfqrwmsnlqgsbqfwsdnfvzthmbplvszfcmlptlcjpnfpjsphsmmjplwjqphgvzbtbjtpttqhlwtgnrjvmvsfsztmsqszzlhqqhfslsvhzgtsssfctzgsqbgdzlpwbsmpcnjqshhhcwqdsdzdhnjfqzqnqdlrpddcgrgldgqbjmdtwgppdczzrjvmcfqjbpjzbtjmgdphlbwnsnpfdqlhwvvmpwzsrztnwvtlbphljmjwsgbphgmwhdmfhpvsmvsjccjhfvqtvfmmlnggncltvtrgmbtfqsvfnlvcmjnjwzcrpjnsgntvhjbtdlptshbhhchqmsprhqzdnfpjqccdfvnzjtlbsmmwvzlwlvmsbrnhqctvtvbfhntdctjnrbcrrlmsnwbbjbcbbgrrhfqwzwwfgvsvgbwnttghtgpspzwzfhffsqjvwwttntnvlwftsfvtttgnprzrzsghvjrdtsfdvzswhmrfcdqsgvrlhzbnvbmjlqrftnnbtwqtvlvwznfbslhdqjbntdgpprfqchjvgvzjssdztjlzwfljjmfvzrbbtczggzqwrnqqgzzcbqjcpfqfrbwtdjrrvbszsjdjcpdfjscsvnltcgwvqsgnhbfgnfnddnpmbzbptrmvqzpvbdpfdvtlmgnnjwflgdbfnmvsdnmlvgcpwflwvdbtbfwtfpsmqsplnzwlwgvbjrhghwrnrswsggbqpdjcjrgbgnsqdvwzzwftvjqgjzzcdvpbbjzpphmbcqmrjvgqwfgrsnqvhwflmhgrlvbpwdcsrlqwfrwppqbrdhwqtvczpclpsbsjcptgblbbsqmbhjjgzwvlcnhnzcttmpjsgchmppgphqlzlcsqcgbbjgtjjvmttdztfdptzgvmpnqrcmpmcdlpnbztllvqbggqbqhlqvdwsrwzsjwfrqvcbvsgfdptmrzpvdfblmhlzrvpmsljlqqzrhlnmwncpfhvqlsbtrjbfcrnfvjvddrhdbbczjdsrdvzlbqrccssdzcpmdsqbprjppfzdwfdswptgzcmjqfhcwsqfqhvrslffqfbcvhdzljzrmtwmfdwzdhhjcmbjtvjhzzwfqhrcslztdbnlwmmhbbbgdscjcdzftnchqfnflnsdqjscfrqpnfbftpzvtmrwncqfqqflschpfnjsjlqcjdjgtwpqhgcnjdmnnvmmpwdspmnrgqrptqwcvbtdwpqlbtwpqgwgfrzlrhtvrvzhmhmwhfdsrhpcczqfltsgtgrfwcvlcvtlhqqwnrqgzpnzbfmzbdwqwbsfvbshrgzqdbgvrhzhzlbqsfzttmsnmrqmwgtzbvdqdrbgcpclzjrhdbjtpcdbbznjgtbwbqrnpvffdmwtrbhhstcmnjcwbbnmpbvmjprtzgcptmtrffwhvfgdljnrbbrblbfbgdwtjrtgqgrpvpgjqrjzczvvlspgdbzftqgqvgdqlglbgvgjdcztznszcwfqhmwbrbjcfstzdcmdsssqfhtzpdgmzjscvbdzgbhhgdqgvfwrzmhdrhlsvlzjjzbzdljcbhncppwrtptjgszlqsrqpzqcsgvdvzmgvwgsncnbffttslphcstqvfwbwzbflmshcbnhpljgqwmmwwzlgpbcqnrtqlwcjcrclfdrnnmvtbfdztdfvtqrsgdptfcfpzpsldhzmrngggfvdqggtlfqqwsldprcffsstnnpmsbbvghdbpprqbssnprdbqclzqtgsrczwcvqwrrfmmfwsndvtvqljwwglrgbphdvvwgctbbmtrbpzqtspgrlhmnhjcdwhwvssgspzjbcfjttjqbdpdmptfzzjcfqljpqddfssmffqprvbptfvdshsdmfmdtmlbnmbmjjjsgmlmwmgcwhbrbgchrstptvdlqgddfzddlzhwjmsvvcjwvqtzjtsctfmzchlbrvlgdzbvdlbfpvhptpltrdmcgjghcpwvwqqnrzdtnmgdncplhdpsgpnbprbgshffwwsdhpgqsbmwdtpnhhltlcqfrjtswcchzvlhdgrmjwhgwppdjqlgmdhwbllqvzrchgclmqdlghjsvmwlflmhhmdzbfjhjnvwphnjbclmdpgflqgtfsmsjslntfcmtbphnrgpdcqtjzjttdtgjmvhzsrfnrjqssvwpcslpfstbpfsrsntmftmdgsqrrsnddqfmchrhtlhmqndvvllnvltdzfphjqnvmcdsgfpcmjftgdpntjzplqljhtthvnbzbzwvfnqsjvnfwhmtbsspjslgfjvdgfjpwrsgqwntntjcqtdgnhnsfwhhqfwbwhdrftj

2022/inputs/07.txt

@@ -0,0 +1,983 @@
+$ cd /
+$ ls
+dir gqcclj
+dir lmtpm
+dir nhqwt
+dir qcq
+dir vwqwlqrt
+$ cd gqcclj
+$ ls
+62425 dqp.gjm
+174181 hrtw.qsd
+273712 pflp.mdw
+169404 zlthnlhf.mtn
+180878 zprprf
+$ cd ..
+$ cd lmtpm
+$ ls
+dir clffsvcw
+163587 cvcl.jqh
+dir dcqnblb
+dir dtpwln
+dir fvt
+dir hrcrw
+dir jdqzmqn
+236754 nrdmlj
+205959 pflp.mdw
+dir qcq
+dir rsn
+129926 vdgcqdn.sqd
+dir zprprf
+$ cd clffsvcw
+$ ls
+6997 dcqnblb.wbh
+145711 dqp
+159225 pflp.mdw
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir dcqnblb
+dir gfn
+dir lpswsp
+dir lvt
+dir zprprf
+$ cd dcqnblb
+$ ls
+2020 grpdmd.ggz
+dir zpswzfvg
+$ cd zpswzfvg
+$ ls
+206998 zprprf.gnw
+$ cd ..
+$ cd ..
+$ cd gfn
+$ ls
+277530 rhbvtblc.mvw
+$ cd ..
+$ cd lpswsp
+$ ls
+173180 dcqnblb
+$ cd ..
+$ cd lvt
+$ ls
+dir hjllwsvl
+dir ptbt
+$ cd hjllwsvl
+$ ls
+dir wqnc
+$ cd wqnc
+$ ls
+64695 grpdmd.ggz
+$ cd ..
+$ cd ..
+$ cd ptbt
+$ ls
+150880 vvbt.gtp
+$ cd ..
+$ cd ..
+$ cd zprprf
+$ ls
+dir ldzslndn
+dir qftt
+$ cd ldzslndn
+$ ls
+dir bwqqsbhg
+129454 vbn
+$ cd bwqqsbhg
+$ ls
+108701 zprprf.gss
+$ cd ..
+$ cd ..
+$ cd qftt
+$ ls
+64268 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dtpwln
+$ ls
+196215 cvcl.jqh
+dir dpwg
+dir ldzslndn
+dir znnsqqh
+$ cd dpwg
+$ ls
+192388 gmh
+47754 grgzh.qdl
+99449 hqsh
+dir pbmf
+50061 pflp.mdw
+192902 qcq.pgg
+dir rmpvj
+dir scgc
+$ cd pbmf
+$ ls
+210083 wpfnwbl.mgf
+$ cd ..
+$ cd rmpvj
+$ ls
+125738 nmlnbvrd
+226214 zprprf.jnp
+114257 zprprf.srs
+$ cd ..
+$ cd scgc
+$ ls
+182115 rrc.rcc
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+201992 qcrm.cpd
+$ cd ..
+$ cd znnsqqh
+$ ls
+85635 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd fvt
+$ ls
+dir dcqnblb
+dir gnc
+75864 vfn
+$ cd dcqnblb
+$ ls
+dir dcqnblb
+dir lbnflwsh
+$ cd dcqnblb
+$ ls
+269901 cvcl.jqh
+$ cd ..
+$ cd lbnflwsh
+$ ls
+33336 grpdmd.ggz
+42861 phg.wmc
+$ cd ..
+$ cd ..
+$ cd gnc
+$ ls
+dir jhjbjsp
+dir jjppr
+$ cd jhjbjsp
+$ ls
+96177 ldzslndn
+$ cd ..
+$ cd jjppr
+$ ls
+181016 dqp
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd hrcrw
+$ ls
+261376 dtjfpppr.dww
+54658 vsrgvw.pfn
+$ cd ..
+$ cd jdqzmqn
+$ ls
+52342 dcpndc.vlg
+171946 gggpchh.tbb
+dir ldzslndn
+11156 nbfrfvv.gzw
+$ cd ldzslndn
+$ ls
+107873 cvcl.jqh
+216034 gfdjrbz
+68844 pqllfrrh.jcf
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+152886 ldzslndn.ltn
+105125 vwplh.vbf
+$ cd ..
+$ cd rsn
+$ ls
+15385 hqcmjdgv.jjv
+105735 qcq.bzg
+58805 snczcsp
+26668 vbn
+$ cd ..
+$ cd zprprf
+$ ls
+dir chbmq
+dir dcqnblb
+dir dqp
+dir nfspb
+89506 zprprf.hnt
+$ cd chbmq
+$ ls
+dir cnjvw
+dir dqp
+151434 frsvrdnt
+dir msztjvcb
+240689 qcq.jlh
+dir sjzrcg
+97312 vnr.zfr
+dir zprprf
+$ cd cnjvw
+$ ls
+dir bpbs
+252403 cqhtshc
+dir djmjhn
+10935 fhqmswr
+6582 pdwml.ldd
+dir qcq
+219282 rfmd
+$ cd bpbs
+$ ls
+147582 bnhwsnsj.gdm
+61362 cvcl.jqh
+152857 vdgcqdn.sqd
+$ cd ..
+$ cd djmjhn
+$ ls
+dir bjdbcjbb
+dir dcqnblb
+dir dqp
+dir lgdwtt
+$ cd bjdbcjbb
+$ ls
+110710 cvcl.jqh
+252792 hmshctr.lgz
+dir mjhtmbj
+189745 shsswcgr
+dir tfnhp
+194940 vbn
+dir zprprf
+$ cd mjhtmbj
+$ ls
+dir dqp
+dir hbthpcmb
+$ cd dqp
+$ ls
+200832 sbcrz.qgw
+$ cd ..
+$ cd hbthpcmb
+$ ls
+55191 ffcntg
+$ cd ..
+$ cd ..
+$ cd tfnhp
+$ ls
+276825 dqp
+161538 gqmr.wgb
+$ cd ..
+$ cd zprprf
+$ ls
+287638 dcqnblb.ssp
+41274 hgmrvj.mwf
+249118 sbb.gsf
+105141 wwrg.gqz
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+1957 btmmc
+32386 dtzbzg.dhm
+dir mmrbj
+98283 ntmhfgtl.pmf
+dir zprprf
+$ cd mmrbj
+$ ls
+273194 wnsq
+251527 zprprf
+$ cd ..
+$ cd zprprf
+$ ls
+27678 ldzslndn.rrl
+62866 ljf.fdj
+148502 qcq.dlg
+dir rvgqvm
+179231 tllnmhn.pjp
+64033 vbn
+dir zcdrj
+$ cd rvgqvm
+$ ls
+dir ntbv
+262324 prhgj.szz
+dir qbvdh
+$ cd ntbv
+$ ls
+116608 cgv.fvj
+175200 swpswq.twt
+$ cd ..
+$ cd qbvdh
+$ ls
+160353 sdhfrb.wjn
+$ cd ..
+$ cd ..
+$ cd zcdrj
+$ ls
+283262 ctl
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir jfzm
+111438 rdrgb.mjf
+64194 wgtmqrq
+dir zprprf
+$ cd jfzm
+$ ls
+158774 pflp.mdw
+$ cd ..
+$ cd zprprf
+$ ls
+215264 sgsstcp
+$ cd ..
+$ cd ..
+$ cd lgdwtt
+$ ls
+dir qcq
+$ cd qcq
+$ ls
+165461 ldzslndn.vvb
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+dir dpd
+165044 grpdmd.ggz
+82343 ldzslndn
+dir mwg
+176689 psjcwp.wct
+44404 qcq.zwd
+$ cd dpd
+$ ls
+84087 dqp
+227386 zprprf.gfs
+$ cd ..
+$ cd mwg
+$ ls
+214086 pflp.mdw
+dir sjjsdn
+225859 wcdt
+158892 zprprf.frs
+$ cd sjjsdn
+$ ls
+260121 gplgp.dfn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir hcrwclpg
+dir zphd
+$ cd hcrwclpg
+$ ls
+dir cmqntjj
+16393 ldzslndn.qbm
+91152 qqdtc.zdq
+$ cd cmqntjj
+$ ls
+272266 ldzslndn.pll
+$ cd ..
+$ cd ..
+$ cd zphd
+$ ls
+165711 chftwcsw.fqw
+256871 cvcl.jqh
+251168 zprprf.gfv
+$ cd ..
+$ cd ..
+$ cd msztjvcb
+$ ls
+206231 brzn.lmn
+dir dcqnblb
+21571 dqp
+dir fmn
+45779 mlfctz.cjr
+288827 pflp.mdw
+220578 qcq.fqf
+$ cd dcqnblb
+$ ls
+198121 ghbwgs
+93681 nmqhl.vpq
+$ cd ..
+$ cd fmn
+$ ls
+29407 mdfws.qvs
+$ cd ..
+$ cd ..
+$ cd sjzrcg
+$ ls
+155120 ddclvsjr.rpq
+136029 ldzslndn.dcm
+dir vhzh
+$ cd vhzh
+$ ls
+212446 vbn
+$ cd ..
+$ cd ..
+$ cd zprprf
+$ ls
+240335 crt.gqh
+185363 gnmm.qgh
+dir ldzslndn
+dir nwl
+dir qll
+277043 vbn
+217796 vtvgpdl.vtm
+$ cd ldzslndn
+$ ls
+273570 cvcl.jqh
+68510 fgdmz.hrc
+dir npq
+dir swjrzzrm
+$ cd npq
+$ ls
+97923 dzcjsqwt
+$ cd ..
+$ cd swjrzzrm
+$ ls
+180599 tmpgn.bjf
+$ cd ..
+$ cd ..
+$ cd nwl
+$ ls
+171833 dlwrfhh.qgn
+$ cd ..
+$ cd qll
+$ ls
+219926 dcqnblb.bvn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir lvpb
+276198 tbgcm.qct
+$ cd lvpb
+$ ls
+142590 bvhjlld
+268259 gnjfg.sgb
+dir qcq
+206220 qcq.zsg
+258137 rrsw.dnb
+dir tmr
+215549 vbn
+$ cd qcq
+$ ls
+dir mmpgd
+dir tdsz
+dir tmfvsjwc
+$ cd mmpgd
+$ ls
+70793 jwbnpwnn
+$ cd ..
+$ cd tdsz
+$ ls
+246310 tdvrhhg.bzq
+$ cd ..
+$ cd tmfvsjwc
+$ ls
+103899 grpdmd.ggz
+287850 ldzslndn
+125930 llhr
+$ cd ..
+$ cd ..
+$ cd tmr
+$ ls
+83344 fbtfcg.hqp
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir lbgmcbv
+dir nbg
+$ cd lbgmcbv
+$ ls
+81776 wzdzzdp
+$ cd ..
+$ cd nbg
+$ ls
+dir mfsgjp
+155574 pflp.mdw
+$ cd mfsgjp
+$ ls
+199400 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd nfspb
+$ ls
+262412 csrdtbs
+73867 vbn
+136389 zqps.hjt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd nhqwt
+$ ls
+123766 cvcl.jqh
+dir dhrtvctp
+222086 grpdmd.ggz
+dir gzg
+26005 lhpmz.tgz
+dir mcnjwwfr
+117122 msn.gst
+$ cd dhrtvctp
+$ ls
+224079 vdgcqdn.sqd
+$ cd ..
+$ cd gzg
+$ ls
+124395 dqp
+dir wqdbtqm
+$ cd wqdbtqm
+$ ls
+237354 pflp.mdw
+212019 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd mcnjwwfr
+$ ls
+92504 cshdztf
+dir dctl
+dir dqp
+dir flcrmhlj
+161879 grpdmd.ggz
+dir gtt
+dir hlbnhchz
+220093 mdtdsgvm.zgg
+dir twntr
+287192 vbn
+$ cd dctl
+$ ls
+dir bbhch
+155396 hrrj.jzm
+164971 pblqmwj.vdb
+dir wnlgfpvf
+$ cd bbhch
+$ ls
+dir dpqtp
+dir jvdrcw
+$ cd dpqtp
+$ ls
+174135 gwb.qrb
+$ cd ..
+$ cd jvdrcw
+$ ls
+215993 dcqnblb.cqp
+200800 stjttf.ngc
+$ cd ..
+$ cd ..
+$ cd wnlgfpvf
+$ ls
+135978 cvcl.jqh
+dir dqp
+54018 lbrfmt
+$ cd dqp
+$ ls
+270516 dcqnblb.jqw
+dir dqp
+144626 grpdmd.ggz
+157731 hvcv.rhp
+133773 lnnt
+76250 vdgcqdn.sqd
+$ cd dqp
+$ ls
+41504 zprprf.cmc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir dqp
+dir ldzslndn
+236737 mqzcvm.fjh
+239746 nhcdz.ncj
+dir rpchqq
+248824 vdgcqdn.sqd
+250937 zrchht.mwg
+$ cd dqp
+$ ls
+203381 qcq.djm
+$ cd ..
+$ cd ldzslndn
+$ ls
+dir dqp
+dir fptnzlv
+dir gmbnpm
+dir vhvblt
+$ cd dqp
+$ ls
+19579 qcq.lhg
+$ cd ..
+$ cd fptnzlv
+$ ls
+209930 dcqnblb
+$ cd ..
+$ cd gmbnpm
+$ ls
+dir ldzslndn
+dir qcq
+$ cd ldzslndn
+$ ls
+11075 pflp.mdw
+$ cd ..
+$ cd qcq
+$ ls
+dir tdp
+$ cd tdp
+$ ls
+40741 vdgcqdn.sqd
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd vhvblt
+$ ls
+dir lzr
+$ cd lzr
+$ ls
+62245 gbnj.llg
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd rpchqq
+$ ls
+dir bcs
+dir dcqnblb
+dir fvjzn
+dir lrphzrv
+$ cd bcs
+$ ls
+179794 bbn.dzb
+242069 cmjdmzjf.zgf
+1703 cvcl.jqh
+dir gnmhwj
+dir ldzslndn
+152520 qltpsz.jsj
+dir sqqjfps
+$ cd gnmhwj
+$ ls
+dir gvs
+201600 hptn.ftf
+dir hzrnb
+dir qcq
+dir sqhl
+$ cd gvs
+$ ls
+152358 zprprf.mlh
+$ cd ..
+$ cd hzrnb
+$ ls
+94290 gplsfd
+$ cd ..
+$ cd qcq
+$ ls
+91909 vmqd.bmg
+$ cd ..
+$ cd sqhl
+$ ls
+238673 vdgcqdn.sqd
+262885 zmdvr.nfg
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+240461 mdz
+84303 qtj
+$ cd ..
+$ cd sqqjfps
+$ ls
+88753 fwn.tff
+$ cd ..
+$ cd ..
+$ cd dcqnblb
+$ ls
+dir dqp
+189996 dqp.pvp
+$ cd dqp
+$ ls
+dir qvfjz
+196506 vbn
+$ cd qvfjz
+$ ls
+209316 pflp.mdw
+107459 rwpbh.vpt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fvjzn
+$ ls
+241464 cvcl.jqh
+dir dqp
+dir ldzslndn
+dir msp
+125 pflp.mdw
+131895 vbn
+$ cd dqp
+$ ls
+34019 pflp.mdw
+202957 vbn
+$ cd ..
+$ cd ldzslndn
+$ ls
+147492 cvcl.jqh
+248719 spc.rfv
+$ cd ..
+$ cd msp
+$ ls
+184407 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd lrphzrv
+$ ls
+dir bbwqmbg
+81858 cvcl.jqh
+dir dqp
+248670 gqqsww.tsn
+199141 grpdmd.ggz
+dir ldzslndn
+34514 ldzslndn.ctw
+dir tln
+214615 zprprf.fwm
+$ cd bbwqmbg
+$ ls
+129750 flf
+dir pvlw
+dir qcq
+126 sqcqphz.tbm
+$ cd pvlw
+$ ls
+198005 jfvj.hdv
+$ cd ..
+$ cd qcq
+$ ls
+dir wgdzws
+$ cd wgdzws
+$ ls
+253522 ldzslndn.qwt
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+281993 cvcl.jqh
+dir hwqjlwcb
+50532 msccz.qgm
+102187 trv.tnq
+111 wplnmj.bfl
+$ cd hwqjlwcb
+$ ls
+267580 dhjqb.dsb
+153195 ldzslndn.jqv
+41526 mvwcwc.zsc
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+58666 cvcl.jqh
+79950 dqp.tmc
+242217 hns.lrb
+dir njswzh
+240692 vdgcqdn.sqd
+dir zvmjvcdm
+52909 zzh
+$ cd njswzh
+$ ls
+149732 cvcl.jqh
+dir rnmfd
+$ cd rnmfd
+$ ls
+75368 dqp.hmv
+14350 vbn
+$ cd ..
+$ cd ..
+$ cd zvmjvcdm
+$ ls
+dir jgczt
+$ cd jgczt
+$ ls
+dir qcq
+95941 qzvvwshv.jwc
+$ cd qcq
+$ ls
+273942 pflp.mdw
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd tln
+$ ls
+dir bmcng
+1518 lrg
+dir vnjfrhp
+$ cd bmcng
+$ ls
+38917 fqcrt
+$ cd ..
+$ cd vnjfrhp
+$ ls
+dir dcqnblb
+dir dqp
+247186 grpdmd.ggz
+dir ldzslndn
+169216 pflp.mdw
+206487 vdgcqdn.sqd
+16976 vlsrzjmb.mmc
+257938 wjl
+$ cd dcqnblb
+$ ls
+dir dqp
+$ cd dqp
+$ ls
+184133 qcq
+$ cd ..
+$ cd ..
+$ cd dqp
+$ ls
+dir dcqnblb
+31612 dqp.pnt
+212283 ldzslndn
+61600 vdbfc.ddj
+197189 wpv.wff
+$ cd dcqnblb
+$ ls
+62412 tfzllmrj
+dir zprprf
+$ cd zprprf
+$ ls
+dir bqnpsl
+dir dszrvpzc
+$ cd bqnpsl
+$ ls
+261548 spbsbbsw.cmn
+$ cd ..
+$ cd dszrvpzc
+$ ls
+188232 sggpqslr.smn
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ldzslndn
+$ ls
+dir bgnhd
+dir pgvcdzwz
+dir qgzhm
+$ cd bgnhd
+$ ls
+56989 cvcl.jqh
+$ cd ..
+$ cd pgvcdzwz
+$ ls
+110034 qhgnndv
+$ cd ..
+$ cd qgzhm
+$ ls
+247232 grpdmd.ggz
+269292 ldzslndn
+153843 tpz
+dir vnschqwr
+162392 wnq.btb
+$ cd vnschqwr
+$ ls
+43005 fvtvzfqm.jvc
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd flcrmhlj
+$ ls
+245668 dcqnblb.sdj
+dir lffj
+229909 pflp.mdw
+280176 vbn
+$ cd lffj
+$ ls
+116451 jmzz.jdd
+dir pjlwb
+162815 pmhlqq.snr
+226183 zffth
+$ cd pjlwb
+$ ls
+67518 qcq.hjq
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd gtt
+$ ls
+52105 grpdmd.ggz
+126869 zprprf.fgj
+$ cd ..
+$ cd hlbnhchz
+$ ls
+3064 dqp.lrw
+278756 grpdmd.ggz
+177208 ldzslndn.wlv
+141685 vbn
+$ cd ..
+$ cd twntr
+$ ls
+63747 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd qcq
+$ ls
+226858 cwblp.zgp
+dir jjqsmfhr
+dir rjbqtrq
+dir vwmpnbts
+141715 wdbhdch
+286381 zprprf
+$ cd jjqsmfhr
+$ ls
+dir btmm
+dir fqndtlgq
+$ cd btmm
+$ ls
+4031 dqp.lrr
+dir fzdd
+$ cd fzdd
+$ ls
+dir vnwpn
+$ cd vnwpn
+$ ls
+dir bzlgsl
+dir ztvzrrbv
+$ cd bzlgsl
+$ ls
+9294 ldzslndn.sqr
+$ cd ..
+$ cd ztvzrrbv
+$ ls
+256017 cvcl.jqh
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd ..
+$ cd fqndtlgq
+$ ls
+271528 ccbmgp.bwd
+$ cd ..
+$ cd ..
+$ cd rjbqtrq
+$ ls
+122150 ldzslndn
+46467 tpdvp.pjf
+$ cd ..
+$ cd vwmpnbts
+$ ls
+47518 fcrwfzvm
+263343 gmc.lrt
+212764 qcq
+$ cd ..
+$ cd ..
+$ cd vwqwlqrt
+$ ls
+dir psrs
+$ cd psrs
+$ ls
+281998 zprprf.hml

2022/inputs/08.txt

@@ -0,0 +1,99 @@
+133120320210233440424211425033311533112110111336536142004454550513525522325223123404213204010312200
+201131111014211324423255354022022243226445013613610423653614522135534505055120330313403031333103010
+312033232323231244025301315245341424106564334260061464515142114141551050411122254121204214442432210
+101223224313414001513045124413405604251532415616200623342234245060512030200002055453441222043022132
+302000022010423415300513533001221654231646352603366222420353100303160621313144421120541324031322221
+022041343104313414435021243154525050055065506466215004364316065443031303052541012204020300331224312
+103341401201343234101335152026143021665443260024145323023321363412215203352344024010350241320230403
+113420142141151035404302242616255522460104100534576523546245441245051223305614204355454223220120301
+141313120334140413444311032422155464031057323373712672513175353623531154646460010504312302300002224
+222122233241135333145102102244620325637577115357373355166254434732406430504542404102101335430322111
+303334221050505214133200215501142243567431213624743475716112467711442460620524310041114411011423020
+314200333004550151023253063621162447552734266222424315622125733562141045411643325165010440012411104
+002041023423222500521530364652321342767176666734452465675417573276212213343035032650010252311440041
+424112310115314154624123026322722176144615437667237551164455332134452657635041110204303331153310423
+403331525242111322464321027125164326531546671615634451453753666614652523355664316050035035431040223
+043240150545010061116502263626227235517673287377662722735257631252161774623714640414211242003124031
+120153432445266666010553121747235535567222344854553227754373283562766712275433030145041514430322020
+130205252451225625553367153422361135376345652238658565468884466665635712475577163231554521534443142
+111112125502543266131422234726554665525278247588365447865236325776254766323137341434403365242323513
+303144132003506154604725457356146262354554756268227328243768455722852644644163423635454133132303535
+355321430425362320027571672735837582654822875282477453446323242873743335342262324741355251635040132
+134315335666154514547724226424352647855667536237263286847676436882327536177762242121655513144251300
+540433012152253201644772517187257277883368828477658659796427367852347254442546347411045431414354124
+123440236041532033152645165666552487887293658447738333978367787858534683322123676621510536503333401
+513523462114216537146475772264724378429935336847846348444575554346687726237537112655265045664650022
+152254463440132245722174776775434287876777476649865634494799993998688326736773121545343121065304241
+250224151321236513227671833576566739347663376834388478944395578563955424353347453672417622666244155
+515223301360505722213752783545553644495694566664938776366634393433784855746658113613537562051065554
+554241245610333147211334537367835857366454575934899676895788946595666473766285253431355325406031452
+100314521636253352672223432738853968767459797559486648888395749643933624738538781345525612342532041
+341462234622615555235573736647638675877393747847457878744844899855446378852378466172227414636330202
+345125124225634624432677378235488673587578945954767695474694483979633396738646725252521775306550112
+413420352557414334236458423883348897736674897485778466695756868398399557654674634472471146623221025
+251143521254271126368347667353953675589776644454498798849645686658369675764886773874127564444411365
+221413142252611772737673846553885549867478965666795885777985495763559573589863845361134756354652555
+243065641366675316826485533843887969469458797465896675796454946875597936434758642384462157714462066
+520553502161266638252882759578566955579648578498775589886979787578896857766344736358531725733564135
+424035430516117723442423478595343855468789497988556567558494878666699996375768427758374271236421335
+252313015177661777278432468494855844559656687766987679695575558744879656544795683583262246546564621
+066230444571526644743382974447835556985988567697575656976987588986595376466888728567376162756500435
+466346066733165454546438886894789699679455689766757985688888664759568963398874674733715475614334101
+325014552177542688745486585579599747867559596676796865787567755944786444539663262282351475561402534
+241163303516225237353826934978454869995779765759887659668665685578986859343646684568651136735352562
+450361264326612736655359595445797648876877955597997887987765775498545883744548752574473726565411112
+554605215356217343577344399893857478777797855566878769757669857854854856357865565536552164136515351
+526446641376374684266375494495458695869978975788699978669887967564769488567376982882762633361324360
+131314671231526545866684867949989786895865986986978678997899677764988874736369482822342624761635224
+623254034413371684428636874768586849979569867987768799666579796798469744978968758623884477174221325
+451620621666445477562568544366499474968796999686779676678989576768596484478933764745243527321126622
+454130052341168772645439448775675586969558878998779766779998798589986885955369648636673756137543515
+052463667567627485865289577459895546659595768687867979887989666587865576357344373227477771625616331
+460630633631764266522893997758984967975685969969798677679989558694657986684466928784764257141450213
+624130637644652532575536775488944945689777797679988979876565896659695947897698966634635115577122034
+312106635521463635433584476586795448766769568869779667989675669974989668369378542526764316562641343
+162151455625714643563689555468449898859656786796979798687579985864586658783373657585741615177725655
+522113305657225658843435489885646557577988797667968888669868768989959977879557377455733555272325032
+304510566333111422674633384687874565587979787768979689685867565897484896499888736286384551117254613
+501463041455354857783745556844585568845776985978966685877875599798784456633539465754543114144204310
+033044042511137887672349889484876755578886688778959586777755687684946795536886522746575472552603266
+506221035322726455557224463853355996897775558969955685797667999588974556935495475632746634441041151
+433136161743725565262636565676447685475989796568778598958657768879849778786859753335661722543205305
+265454361556653132263478888989675487694888975877759959776785674478666588788563747772733262666414514
+052441631644734262283652379957577654769979687765967795697668686969788694345962866843241632716655446
+236003436545632166356247457495793686988694668988898785686844466844799668333966735544674562633412352
+521460600027621624875854349394389587767654998655578976768847769685597639387383648267451531624063352
+342222114334344716267243334967869638699594976567878976765649455495834476654882454551336614731204621
+033566313156263553885434364795389663465876465857797479766958478858465479967473865454116236530266023
+312652012603144155543338267594667756579949844587785799854455597889659839838335338227724422251205254
+300006533237512225736566526838475448787546947968579975977675656694697397732838257677271224106345603
+133143326544516157647526755363599347754745759889457964588954897669586537634253625642342472416641244
+154255220262671713413357272553997888597745494647794956965689397737688378433337485552276212554465555
+100240040401314462336283253854484757937369955476776566463546476496874852334852883176722554655020500
+114224164252562264455188387248845988369836588899857935337746669656565572827235667727764740332042104
+210035410165643165676172383567428973379998596753776399638478657839665546428878531777515004325230423
+210124643010215635561443542385838474565467799589387569934754637575772733563765332372676641151131504
+302221012422133674231332744234367852633548864367379437949776375866557752335873376756770315423300102
+332125266633066263556242566636554222886478446383395355568773939525563625678526672212234343222625410
+025325451166410144267526457225543863563576656495967865696633785745578788783545643421165350000423343
+002055431510265615765734547166486528454663847694453963495886284323368575223225414276066312104153401
+355245141260142612771253626632378444477523462347872628387736452238277834561572523626005254261254042
+203545210065351052363237141625823577635472367448676276452678742864237273162112414622640501555430121
+335510044411666505051763342712375473385677658477545568853568734655885763312211631300144242225254322
+420503535251235101224431771412136627846753333256668624663675776462422374227471570160056336045543305
+311442220344522144201454355125161416822475756464544562823568565277363143626236634605524051151344323
+221042430004563020306242752654674353744234455564453257548654537765566764222366445225313642034222311
+410315020300414623613025143245525766347157877736466252545465214236744364172443246502214503112203230
+342304354225251006345461616171626576425171512572743837515273314522745717111151266035240243530314400
+101402542354002125435251304674647534521162334775342133371111747561164265140621412560624450505304430
+011211315525203435452400223603127166746242764515517634515312173434163762164444142306041434112503201
+312201041521122523410120106532007714457744313215145447526753371116262403622123305243410143403304001
+420143230433241404304622552610552657576751252637557577175144676122663421114064036341501055504120312
+321114124142324224151525015553652243236362311234247651266113535462142056365353412114023231401141232
+144010233331150422332523034411415500511027722375253755262514425243333354512150011301540445044301243
+321223141143321313415515024451144622413543514327723454716501265226013550620005111202312303242203422
+220312222242043544521300416060642531526303363025212311016020154415132623214322110011054242222314401
+120043213410140522500232142235034335033562221102412305131143065020436150033340525535242031300403012
+333011210021031104353104420453564321600565055235040060414452305642301521213234000231332120021102311
+213000422032423433105500120521112552552162045443040565055142555024614151234210022135411312102303010
+311113213314300134505043355233124354500023350433035532626242646113034040102425400244311432332422101

2022/src/common.rs

@@ -0,0 +1,118 @@
+//! Common helper utilities to all days
+
+use anyhow::Result;
+use nom::combinator::map;
+use nom::error::ErrorKind;
+use nom::error::ParseError;
+use nom::Finish;
+use nom::IResult;
+use nom::InputLength;
+use nom::Parser;
+
+/// Parse input from some nom parser and return as an anyhow result
+///
+/// This method exists as a convenience because nom's errors cannot otherwise be easily converted to
+/// an anyhow error, and I don't want to keep track of custom error implementations here.
+pub fn parse_input<'a, O>(
+    input: &'a [u8],
+    mut parser: impl Parser<&'a [u8], O, nom::error::Error<&'a [u8]>>,
+) -> Result<O> {
+    let (unparsed, output) = parser.parse(input).finish().map_err(|e| {
+        anyhow::anyhow!(
+            "Parser error {:?} to parse at {}",
+            e.code,
+            String::from_utf8_lossy(e.input)
+        )
+    })?;
+
+    if !unparsed.is_empty() {
+        Err(anyhow::anyhow!(
+            "Not all input consumed: {}",
+            String::from_utf8_lossy(unparsed)
+        ))
+    } else {
+        Ok(output)
+    }
+}
+
+/// Applies a parser iteratively and reduces the results using the given function. Fails if the
+/// embedded parser doesn't return at least one result.
+///
+/// # Arguments
+/// - `f`: the function to apply
+/// - `g`: the function that combines the result o `f` with previous results
+///
+/// This implementation is based on [`nom::multi::fold_many1`] with minor differences. If
+/// successful, this should probably be upstreamed.
+pub fn reduce_many1<I, O, E, F>(
+    mut f: F,
+    mut g: impl FnMut(O, O) -> O,
+) -> impl FnMut(I) -> IResult<I, O, E>
+where
+    I: Clone + InputLength,
+    E: ParseError<I>,
+    F: Parser<I, O, E>,
+{
+    // Cannot delegate to fold_many0 because that would make the function FnOnce rather than FnMut,
+    // since it would transfer ownership of the embedded parser to fold_many0.
+    move |i: I| {
+        let _i = i.clone();
+        match f.parse(_i) {
+            Err(nom::Err::Error(_)) => {
+                Err(nom::Err::Error(E::from_error_kind(i, ErrorKind::Many1)))
+            }
+            Err(e) => Err(e),
+            Ok((i1, mut acc)) => {
+                let mut input = i1;
+
+                loop {
+                    let _input = input.clone();
+                    let len = input.input_len();
+                    match f.parse(_input) {
+                        Err(nom::Err::Error(_)) => {
+                            break;
+                        }
+                        Err(e) => return Err(e),
+                        Ok((i, o)) => {
+                            // infinite loop check: the parser must always consume
+                            if i.input_len() == len {
+                                return Err(nom::Err::Failure(E::from_error_kind(
+                                    i,
+                                    ErrorKind::Many1,
+                                )));
+                            }
+
+                            acc = g(acc, o);
+                            input = i;
+                        }
+                    }
+                }
+
+                Ok((input, acc))
+            }
+        }
+    }
+}
+
+/// Add an index to repeated successful invocations of the embedded parser.
+pub fn enumerate<I, O, E>(f: impl Parser<I, O, E>) -> impl FnMut(I) -> IResult<I, (usize, O), E> {
+    let mut index = 0usize;
+
+    map(f, move |v| {
+        let res = (index, v);
+        index += 1;
+        res
+    })
+}
+
+/// Return the minimum and maximum of two unordered variables
+pub fn minmax<T>(a: T, b: T) -> (T, T)
+where
+    T: PartialOrd,
+{
+    if a < b {
+        (a, b)
+    } else {
+        (b, a)
+    }
+}

2022/src/day01.rs

@@ -0,0 +1,50 @@
+use std::ops::Add;
+
+use anyhow::Result;
+use nom::character::complete::newline;
+use nom::multi::separated_list0;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::parse_input;
+use crate::common::reduce_many1;
+
+fn parse_elf(input: &[u8]) -> IResult<&[u8], i32> {
+    reduce_many1(terminated(nom::character::complete::i32, newline), Add::add)(input)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let elves = parse_input(input, parse_elf_list)?;
+    Ok(elves.into_iter().fold(0, Ord::max).to_string())
+}
+
+fn parse_elf_list(input: &[u8]) -> IResult<&[u8], Vec<i32>> {
+    separated_list0(newline, parse_elf)(input)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let mut elves = parse_input(input, parse_elf_list)?;
+
+    let (first, third, _) = elves.select_nth_unstable_by(2, |a, b| Ord::cmp(b, a));
+
+    let result = first[1] + first[0] + *third;
+
+    Ok(result.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/01.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "24000");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "45000");
+    }
+}

2022/src/day02.rs

@@ -0,0 +1,125 @@
+use anyhow::Result;
+use nom::character::complete::newline;
+use nom::combinator::map_res;
+use nom::multi::many0;
+use nom::sequence::separated_pair;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::parse_input;
+
+#[derive(Copy, Clone, Eq, PartialEq)]
+enum Rps {
+    Rock,
+    Paper,
+    Scissors,
+}
+
+impl Rps {
+    /// Score we get by playing this move
+    fn score(self) -> u32 {
+        match self {
+            Rps::Rock => 1,
+            Rps::Paper => 2,
+            Rps::Scissors => 3,
+        }
+    }
+
+    /// Score we get from the result from playing given other
+    fn score_against(self, other: Self) -> u32 {
+        match (self, other) {
+            (a, b) if a == b => 3,
+            (Rps::Rock, Rps::Paper) | (Rps::Paper, Rps::Scissors) | (Rps::Scissors, Rps::Rock) => 0,
+            _ => 6,
+        }
+    }
+
+    /// Score if the result is according to the instruction
+    fn score_result(self) -> u32 {
+        match self {
+            Rps::Rock => 0,     // Rock is lose
+            Rps::Paper => 3,    // Paper is draw
+            Rps::Scissors => 6, // Scissors is win
+        }
+    }
+
+    /// Move we need to achieve the result indicated by self
+    fn needed(self, other: Self) -> Self {
+        match (self, other) {
+            (Rps::Paper, other) => other,
+            (Rps::Rock, Rps::Rock) => Rps::Scissors,
+            (Rps::Rock, Rps::Paper) => Rps::Rock,
+            (Rps::Rock, Rps::Scissors) => Rps::Paper,
+            (Rps::Scissors, Rps::Rock) => Rps::Paper,
+            (Rps::Scissors, Rps::Paper) => Rps::Scissors,
+            (Rps::Scissors, Rps::Scissors) => Rps::Rock,
+        }
+    }
+}
+
+impl TryFrom<u8> for Rps {
+    type Error = anyhow::Error;
+
+    fn try_from(value: u8) -> Result<Self, Self::Error> {
+        match value {
+            b'A' | b'X' => Ok(Rps::Rock),
+            b'B' | b'Y' => Ok(Rps::Paper),
+            b'C' | b'Z' => Ok(Rps::Scissors),
+            _ => Err(anyhow::anyhow!("Invalid RPS: {value}")),
+        }
+    }
+}
+
+fn parse_plan(input: &[u8]) -> IResult<&[u8], Vec<(Rps, Rps)>> {
+    fn parse_rps(input: &[u8]) -> IResult<&[u8], Rps> {
+        // Note: alpha1 also sort of works but is significantly slower
+        map_res(nom::bytes::complete::take(1usize), |v: &[u8]| {
+            Rps::try_from(v[0])
+        })(input)
+    }
+
+    fn parse_line(input: &[u8]) -> IResult<&[u8], (Rps, Rps)> {
+        separated_pair(parse_rps, nom::character::complete::char(' '), parse_rps)(input)
+    }
+
+    many0(terminated(parse_line, newline))(input)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let plan = parse_input(input, parse_plan)?;
+
+    let result: u32 = plan
+        .into_iter()
+        .map(|(them, us)| us.score() + us.score_against(them))
+        .sum();
+
+    Ok(result.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let plan = parse_input(input, parse_plan)?;
+
+    let result: u32 = plan
+        .into_iter()
+        .map(|(them, us)| us.score_result() + us.needed(them).score())
+        .sum();
+
+    Ok(result.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/02.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "15")
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "12")
+    }
+}

2022/src/day03.rs

@@ -0,0 +1,79 @@
+use anyhow::Result;
+use itertools::Itertools;
+
+fn priority(item: u8) -> u32 {
+    match item {
+        b'a'..=b'z' => item - b'a' + 1,
+        b'A'..=b'Z' => item - b'A' + 27,
+        _ => 0,
+    }
+    .into()
+}
+
+fn seen(backpack: &[u8]) -> u64 {
+    let mut seen = 0;
+
+    for &b in backpack {
+        seen |= 1 << priority(b);
+    }
+
+    seen
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let mut total = 0;
+
+    for line in input.split(|&b| b == b'\n') {
+        let (first, last) = line.split_at(line.len() / 2);
+
+        let seen = seen(first);
+
+        for &b in last {
+            let prio = priority(b);
+
+            if (seen & (1 << prio)) != 0 {
+                total += prio;
+                break;
+            }
+        }
+    }
+
+    Ok(total.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let mut total = 0;
+
+    for chunk in &input.split(|&b| b == b'\n').chunks(3) {
+        let mut mask = u64::MAX;
+
+        for backpack in chunk {
+            let seen = seen(backpack);
+            mask &= seen;
+        }
+
+        if mask != 0 {
+            debug_assert_eq!(1, mask.count_ones());
+            total += mask.trailing_zeros();
+        }
+    }
+
+    Ok(total.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/03.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "157")
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "70")
+    }
+}

2022/src/day04.rs

@@ -0,0 +1,86 @@
+use anyhow::Result;
+use nom::bytes::complete::tag;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::multi::many0;
+use nom::sequence::separated_pair;
+use nom::sequence::terminated;
+use nom::IResult;
+
+use crate::common::minmax;
+use crate::common::parse_input;
+
+#[derive(Copy, Clone, PartialOrd, PartialEq)]
+struct Assignment(u32, u32);
+
+impl Assignment {
+    fn one_contains(self, other: Self) -> bool {
+        let (first, second) = minmax(self, other);
+
+        if second.0 == first.0 {
+            first.1 <= second.1
+        } else {
+            second.0 <= first.1 && second.1 <= first.1
+        }
+    }
+
+    fn one_overlaps(self, other: Self) -> bool {
+        let (first, second) = minmax(self, other);
+
+        if second.0 == first.0 {
+            first.1 <= second.1
+        } else {
+            second.0 <= first.1
+        }
+    }
+}
+
+fn parse_assignments(input: &[u8]) -> IResult<&[u8], Vec<(Assignment, Assignment)>> {
+    use nom::character::complete::u32;
+
+    fn parse_single(input: &[u8]) -> IResult<&[u8], Assignment> {
+        map(separated_pair(u32, tag("-"), u32), |(start, end)| {
+            Assignment(start, end)
+        })(input)
+    }
+
+    let parse_line = separated_pair(parse_single, tag(","), parse_single);
+
+    many0(terminated(parse_line, newline))(input)
+}
+
+fn parts_common(input: &[u8], filter: impl Fn(Assignment, Assignment) -> bool) -> Result<String> {
+    let assigments = parse_input(input, parse_assignments)?;
+
+    let overlapping = assigments
+        .into_iter()
+        .filter(|&(a, b)| filter(a, b))
+        .count();
+
+    Ok(overlapping.to_string())
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    parts_common(input, Assignment::one_contains)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    parts_common(input, Assignment::one_overlaps)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/04.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "2")
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "4")
+    }
+}

2022/src/day05.rs

@@ -0,0 +1,166 @@
+use std::cmp::Ordering;
+
+use anyhow::Result;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take;
+use nom::bytes::complete::take_until;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::combinator::opt;
+use nom::multi::fold_many1;
+use nom::multi::many1;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::enumerate;
+use crate::common::parse_input;
+
+type Move = (usize, usize, usize);
+type OwnedStacks = Vec<Vec<u8>>;
+
+fn parse_row<'a>(input: &'a [u8], stacks: &mut OwnedStacks) -> IResult<&'a [u8], ()> {
+    // Forgive me for this crime
+    fold_many1(
+        enumerate(terminated(
+            alt((
+                // Parse a delimited value into a Some(content)
+                map(delimited(tag("["), take(1usize), tag("]")), |v: &[u8]| {
+                    Some(v[0])
+                }),
+                // Or an empty stack into a None
+                map(tag("   "), |_| None),
+            )),
+            opt(tag(" ")),
+        )),
+        || (),
+        move |_, (index, c)| {
+            if let Some(b) = c {
+                if stacks.len() <= index {
+                    stacks.resize_with(index + 1, Vec::new);
+                }
+
+                stacks[index].push(b)
+            }
+        },
+    )(input)
+}
+
+fn parse_stacks(input: &[u8]) -> IResult<&[u8], OwnedStacks> {
+    let mut stacks = Vec::new();
+
+    let (input, _) = terminated(
+        fold_many1(
+            terminated(|input| parse_row(input, &mut stacks), newline),
+            || (),
+            |_, _| (),
+        ),
+        // Skip the line with the numbers
+        take_until("\n\n"),
+    )(input)?;
+
+    // Reverse the stacks since we parsed them top-down
+    for stack in &mut stacks {
+        stack.reverse();
+    }
+
+    Ok((input, stacks))
+}
+
+fn parse_task(input: &[u8]) -> IResult<&[u8], (OwnedStacks, Vec<Move>)> {
+    fn parse_usize(input: &[u8]) -> IResult<&[u8], usize> {
+        map(nom::character::complete::u32, |v| v as usize)(input)
+    }
+    let (input, stacks) = parse_stacks(input)?;
+
+    // Consume the double newline
+    let (input, _) = tag("\n\n")(input)?;
+
+    let (input, moves) = many1(terminated(
+        tuple((
+            preceded(tag("move "), parse_usize),
+            preceded(tag(" from "), parse_usize),
+            preceded(tag(" to "), parse_usize),
+        )),
+        newline,
+    ))(input)?;
+
+    Ok((input, (stacks, moves)))
+}
+
+/// Some magic to get two mutable references into the same slice
+fn get_both(stacks: &mut [Vec<u8>], from: usize, to: usize) -> (&mut Vec<u8>, &mut Vec<u8>) {
+    match from.cmp(&to) {
+        Ordering::Greater => {
+            let (begin, end) = stacks.split_at_mut(from);
+            (&mut end[0], &mut begin[to])
+        }
+        Ordering::Less => {
+            let (begin, end) = stacks.split_at_mut(to);
+            (&mut begin[from], &mut end[0])
+        }
+        Ordering::Equal => panic!("Tried to stack from and to {from}"),
+    }
+}
+
+fn compute_answer(stacks: &mut [Vec<u8>]) -> Result<String> {
+    let mut result = String::with_capacity(stacks.len());
+
+    for stack in stacks {
+        result.push(
+            *stack
+                .last()
+                .ok_or_else(|| anyhow::anyhow!("Encountered empty stack"))? as char,
+        );
+    }
+
+    Ok(result)
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let (mut stacks, moves) = parse_input(input, parse_task)?;
+
+    for (count, from, to) in moves {
+        let (from, to) = get_both(&mut stacks, from - 1, to - 1);
+
+        let drain_start = from.len() - count;
+
+        to.extend(from.drain(drain_start..).rev());
+    }
+
+    compute_answer(&mut stacks)
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let (mut stacks, moves) = parse_input(input, parse_task)?;
+
+    for (count, from, to) in moves {
+        let (from, to) = get_both(&mut stacks, from - 1, to - 1);
+
+        let drain_start = from.len() - count;
+
+        to.extend(from.drain(drain_start..));
+    }
+
+    compute_answer(&mut stacks)
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/05.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "CMZ");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "MCD");
+    }
+}

2022/src/day06.rs

@@ -0,0 +1,68 @@
+use anyhow::Result;
+
+fn find_first(input: &[u8], unique: usize) -> Result<usize> {
+    let mut seen = [false; 256];
+
+    let mut tail_it = input.iter();
+
+    let mut first = 0;
+
+    // Loop invariant: input[first..last] contains only unique characters
+    for (last, &c) in input.iter().enumerate() {
+        if seen[c as usize] {
+            first += (&mut tail_it)
+                .take_while(|&&b| b != c)
+                .map(|&b| seen[b as usize] = false)
+                .count()
+                + 1; // +1 because take_while doesn't return the first element that didn't satisfy the condition, while we do need to count it
+        } else {
+            // New unique character found: input[first..=last] contains unique characters
+            if last - first + 1 == unique {
+                return Ok(last + 1);
+            }
+
+            seen[c as usize] = true;
+        }
+    }
+
+    anyhow::bail!("Did not find unique sequence of length {unique}");
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    Ok(find_first(input, 4)?.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    Ok(find_first(input, 14)?.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLES: &[&[u8]] = &[
+        b"mjqjpqmgbljsphdztnvjfqwrcgsmlb",
+        b"bvwbjplbgvbhsrlpgdmjqwftvncz",
+        b"nppdvjthqldpwncqszvftbrmjlhg",
+        b"nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg",
+        b"zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw",
+    ];
+
+    #[test]
+    fn sample_part1() {
+        const CORRECT: &[usize] = &[7, 5, 6, 10, 11];
+
+        for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
+            assert_eq!(find_first(sample, 4).unwrap(), correct);
+        }
+    }
+
+    #[test]
+    fn sample_part2() {
+        const CORRECT: &[usize] = &[19, 23, 23, 29, 26];
+
+        for (&sample, &correct) in SAMPLES.iter().zip(CORRECT) {
+            assert_eq!(find_first(sample, 14).unwrap(), correct);
+        }
+    }
+}

2022/src/day07.rs

@@ -0,0 +1,124 @@
+use anyhow::Context;
+use anyhow::Result;
+use nom::branch::alt;
+use nom::bytes::complete::tag;
+use nom::bytes::complete::take_until;
+use nom::character::complete::newline;
+use nom::combinator::map;
+use nom::combinator::opt;
+use nom::multi::fold_many0;
+use nom::sequence::delimited;
+use nom::sequence::preceded;
+use nom::sequence::terminated;
+use nom::sequence::tuple;
+use nom::IResult;
+
+use crate::common::parse_input;
+
+fn parse_dir<'a>(
+    input: &'a [u8],
+    dirs: &mut Vec<u32>,
+    dir_stack: &mut Vec<&'a [u8]>,
+) -> IResult<&'a [u8], u32> {
+    use nom::character::complete::u32;
+
+    enum Entry<'a> {
+        File(u32),
+        Dir(&'a [u8]),
+    }
+    let initial_len = dir_stack.len();
+
+    let (mut input, mut size) = preceded(
+        tag("$ ls\n"),
+        fold_many0(
+            // Map many newline-terminated entries
+            terminated(
+                // of either
+                alt((
+                    // A size followed by a name
+                    map(terminated(u32, take_until("\n")), Entry::File),
+                    // Or the word "dir" followed by a name
+                    map(preceded(tag("dir "), take_until("\n")), Entry::Dir),
+                )),
+                newline,
+            ),
+            || 0u32,
+            |files_sum, entry| match entry {
+                Entry::File(size) => files_sum + size,
+                Entry::Dir(name) => {
+                    dir_stack.push(name);
+                    files_sum
+                }
+            },
+        ),
+    )(input)?;
+
+    for i in initial_len..dir_stack.len() {
+        let (new_input, content_size) = delimited(
+            tuple((tag("$ cd "), tag(dir_stack[i]), newline)),
+            |input| parse_dir(input, dirs, dir_stack),
+            // Optional cd'ing out because the last directory is never exited.
+            opt(tag("$ cd ..\n")),
+        )(input)?;
+
+        input = new_input;
+        size += content_size;
+    }
+
+    dirs.push(size);
+    dir_stack.truncate(initial_len);
+
+    Ok((input, size))
+}
+
+fn parse_program(input: &[u8]) -> IResult<&[u8], (u32, Vec<u32>)> {
+    let mut dirs = Vec::new();
+    let mut dirstack = Vec::new();
+    let (input, size) = preceded(tag("$ cd /\n"), |input| {
+        parse_dir(input, &mut dirs, &mut dirstack)
+    })(input)?;
+
+    Ok((input, (size, dirs)))
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let (_, sizes) = parse_input(input, parse_program)?;
+
+    let searched_size: u32 = sizes.into_iter().filter(|&size| size <= 100000).sum();
+
+    Ok(searched_size.to_string())
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    const TARGET: u32 = 30000000;
+    const TOTAL: u32 = 70000000;
+
+    let (used, sizes) = parse_input(input, parse_program)?;
+
+    let required = TARGET - (TOTAL - used);
+
+    let min = sizes
+        .into_iter()
+        .filter(|&size| size >= required)
+        .min()
+        .context("Did not find dir large enough to delete")?;
+
+    Ok(min.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/07.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "95437");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "24933642");
+    }
+}

2022/src/day08.rs

@@ -0,0 +1,163 @@
+use std::cmp::Ordering;
+
+use anyhow::Context;
+use anyhow::Result;
+
+#[inline]
+fn stripe<'a>(
+    values: impl IntoIterator<Item = &'a u8>,
+    visible: impl IntoIterator<Item = &'a mut bool>,
+) {
+    let mut max = 0;
+
+    for (&val, visible) in values.into_iter().zip(visible) {
+        if val > max {
+            max = val;
+            *visible = true;
+
+            if val == b'9' {
+                return;
+            }
+        }
+    }
+}
+
+pub fn part1(input: &[u8]) -> Result<String> {
+    let width = input
+        .iter()
+        .position(|&b| b == b'\n')
+        .context("Single row field")?;
+    let height = input.len() / (width + 1); // Include newlines
+
+    let mut visible = vec![false; width * height];
+
+    // Horizontal striping
+    for (y, row) in input.chunks_exact(width + 1).enumerate() {
+        // First, left to right
+        stripe(&row[..width], &mut visible[(y * width)..]);
+
+        // Then right to left
+        stripe(
+            row[..width].iter().rev(),
+            visible[(y * width)..(y * width + width)].iter_mut().rev(),
+        );
+    }
+
+    // Vertical striping
+    for x in 0..width {
+        // Top to bottom
+        stripe(
+            input[x..].iter().step_by(width + 1),
+            visible[x..].iter_mut().step_by(width),
+        );
+
+        // Bottom to top
+        stripe(
+            input[x..].iter().step_by(width + 1).rev(),
+            visible[x..].iter_mut().step_by(width).rev(),
+        )
+    }
+
+    Ok(visible.into_iter().filter(|&b| b).count().to_string())
+}
+
+#[inline]
+fn scenery<'a>(
+    values: impl IntoIterator<Item = &'a u8>,
+    visible: impl IntoIterator<Item = &'a mut usize>,
+    tree_stack: &mut Vec<(usize, u8)>,
+) {
+    tree_stack.clear();
+
+    for (i, (&val, score)) in values.into_iter().zip(visible).enumerate() {
+        scenery_helper(i, tree_stack, val, score);
+    }
+}
+
+fn scenery_helper(i: usize, tree_stack: &mut Vec<(usize, u8)>, val: u8, score: &mut usize) {
+    if i > 0 {
+        let mut first = 0;
+
+        while let Some((pos, other)) = tree_stack.pop() {
+            match other.cmp(&val) {
+                Ordering::Less => (),
+                Ordering::Equal => {
+                    first = pos;
+                    break;
+                }
+                Ordering::Greater => {
+                    tree_stack.push((pos, other));
+                    first = pos;
+                    break;
+                }
+            }
+        }
+
+        tree_stack.push((i, val));
+
+        *score *= i - first;
+    } else {
+        *score = 0;
+    }
+}
+
+pub fn part2(input: &[u8]) -> Result<String> {
+    let width = input
+        .iter()
+        .position(|&b| b == b'\n')
+        .context("Single row field")?;
+    let height = input.len() / (width + 1); // Include newlines
+
+    let mut score = vec![1; width * height];
+
+    let mut tree_stack = Vec::with_capacity(10);
+
+    // Horizontal striping
+    for (y, row) in input.chunks_exact(width + 1).enumerate() {
+        // First, left to right
+        scenery(&row[..width], &mut score[(y * width)..], &mut tree_stack);
+
+        // Then right to left
+        scenery(
+            row[..width].iter().rev(),
+            score[(y * width)..(y * width + width)].iter_mut().rev(),
+            &mut tree_stack,
+        );
+    }
+
+    // Vertical striping
+    for x in 0..width {
+        // Top to bottom
+        scenery(
+            input[x..].iter().step_by(width + 1),
+            score[x..].iter_mut().step_by(width),
+            &mut tree_stack,
+        );
+
+        // Bottom to top
+        scenery(
+            input[x..].iter().step_by(width + 1).rev(),
+            score[x..].iter_mut().step_by(width).rev(),
+            &mut tree_stack,
+        )
+    }
+
+    Ok(score.into_iter().max().context("empty field")?.to_string())
+}
+
+#[cfg(test)]
+mod tests {
+    use super::*;
+
+    const SAMPLE: &[u8] = include_bytes!("samples/08.txt");
+
+    #[test]
+    fn sample_part1() {
+        assert_eq!(part1(SAMPLE).unwrap(), "21");
+    }
+
+    #[test]
+    fn sample_part2() {
+        assert_eq!(part2(SAMPLE).unwrap(), "8");
+    }
+}

2022/src/day09.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day10.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day11.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day12.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day13.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day14.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day15.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day16.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day17.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day18.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day19.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day20.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day21.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day22.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day23.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day24.rs

@@ -0,0 +1,9 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}
+
+pub fn part2(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/day25.rs

@@ -0,0 +1,5 @@
+use anyhow::Result;
+
+pub fn part1(_input: &[u8]) -> Result<String> {
+    anyhow::bail!("not implemented")
+}

2022/src/lib.rs

@@ -0,0 +1,91 @@
+use anyhow::Result;
+
+mod common;
+mod day01;
+mod day02;
+mod day03;
+mod day04;
+mod day05;
+mod day06;
+mod day07;
+mod day08;
+mod day09;
+mod day10;
+mod day11;
+mod day12;
+mod day13;
+mod day14;
+mod day15;
+mod day16;
+mod day17;
+mod day18;
+mod day19;
+mod day20;
+mod day21;
+mod day22;
+mod day23;
+mod day24;
+mod day25;
+
+type Solution = fn(&[u8]) -> Result<String>;
+
+pub fn get_implementation(day: u8, part2: bool) -> Result<Solution> {
+    if !part2 {
+        match day {
+            1 => Ok(day01::part1),
+            2 => Ok(day02::part1),
+            3 => Ok(day03::part1),
+            4 => Ok(day04::part1),
+            5 => Ok(day05::part1),
+            6 => Ok(day06::part1),
+            7 => Ok(day07::part1),
+            8 => Ok(day08::part1),
+            9 => Ok(day09::part1),
+            10 => Ok(day10::part1),
+            11 => Ok(day11::part1),
+            12 => Ok(day12::part1),
+            13 => Ok(day13::part1),
+            14 => Ok(day14::part1),
+            15 => Ok(day15::part1),
+            16 => Ok(day16::part1),
+            17 => Ok(day17::part1),
+            18 => Ok(day18::part1),
+            19 => Ok(day19::part1),
+            20 => Ok(day20::part1),
+            21 => Ok(day21::part1),
+            22 => Ok(day22::part1),
+            23 => Ok(day23::part1),
+            24 => Ok(day24::part1),
+            25 => Ok(day25::part1),
+            _ => anyhow::bail!("Invalid day for part 1: {day}"),
+        }
+    } else {
+        match day {
+            1 => Ok(day01::part2),
+            2 => Ok(day02::part2),
+            3 => Ok(day03::part2),
+            4 => Ok(day04::part2),
+            5 => Ok(day05::part2),
+            6 => Ok(day06::part2),
+            7 => Ok(day07::part2),
+            8 => Ok(day08::part2),
+            9 => Ok(day09::part2),
+            10 => Ok(day10::part2),
+            11 => Ok(day11::part2),
+            12 => Ok(day12::part2),
+            13 => Ok(day13::part2),
+            14 => Ok(day14::part2),
+            15 => Ok(day15::part2),
+            16 => Ok(day16::part2),
+            17 => Ok(day17::part2),
+            18 => Ok(day18::part2),
+            19 => Ok(day19::part2),
+            20 => Ok(day20::part2),
+            21 => Ok(day21::part2),
+            22 => Ok(day22::part2),
+            23 => Ok(day23::part2),
+            24 => Ok(day24::part2),
+            _ => anyhow::bail!("Invalid day for part 2: {day}"),
+        }
+    }
+}

2022/src/main.rs

@@ -0,0 +1,61 @@
+use std::fs::File;
+use std::io::Read;
+use std::num::NonZeroU8;
+use std::path::PathBuf;
+use std::time::Instant;
+
+use anyhow::Result;
+use clap::Parser;
+
+use aoc_2022::get_implementation;
+
+/// Advent of Code 2022 runner
+#[derive(Parser)]
+struct Opts {
+    /// Which day to run
+    day: NonZeroU8,
+
+    /// Print time taken
+    #[clap(short, long)]
+    time: bool,
+
+    /// Run part 2 instead of part 1
+    #[clap(short = '2', long)]
+    part2: bool,
+
+    /// Read input from the given file instead of stdin
+    #[clap(short, long)]
+    input: Option<PathBuf>,
+}
+
+impl Opts {
+    fn input_data(&self) -> Result<Vec<u8>> {
+        let mut buffer = Vec::new();
+
+        if let Some(input) = &self.input {
+            File::open(input)?.read_to_end(&mut buffer)?;
+        } else {
+            std::io::stdin().read_to_end(&mut buffer)?;
+        }
+
+        Ok(buffer)
+    }
+}
+
+fn main() -> Result<()> {
+    let opts: Opts = Opts::parse();
+
+    let input = opts.input_data()?;
+
+    let implementation = get_implementation(opts.day.get(), opts.part2)?;
+
+    let begin = Instant::now();
+    let result = implementation(&input)?;
+
+    if opts.time {
+        eprintln!("Execution time: {:?}", Instant::now().duration_since(begin));
+    }
+
+    println!("{}", result);
+    Ok(())
+}

2022/src/samples/01.txt

@@ -0,0 +1,14 @@
+1000
+2000
+3000
+
+4000
+
+5000
+6000
+
+7000
+8000
+9000
+
+10000

2022/src/samples/02.txt

@@ -0,0 +1,3 @@
+A Y
+B X
+C Z

2022/src/samples/03.txt

@@ -0,0 +1,6 @@
+vJrwpWtwJgWrhcsFMMfFFhFp
+jqHRNqRjqzjGDLGLrsFMfFZSrLrFZsSL
+PmmdzqPrVvPwwTWBwg
+wMqvLMZHhHMvwLHjbvcjnnSBnvTQFn
+ttgJtRGJQctTZtZT
+CrZsJsPPZsGzwwsLwLmpwMDw

2022/src/samples/04.txt

@@ -0,0 +1,6 @@
+2-4,6-8
+2-3,4-5
+5-7,7-9
+2-8,3-7
+6-6,4-6
+2-6,4-8